(data stored in ACNUC7421 zone)

EMBL: CP001600.PE121

CP001600.PE121       Location/Qualifiers
FT   CDS_pept        128090..129223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0129"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67384"
FT                   /db_xref="GOA:C5BC93"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC93"
FT                   /protein_id="ACR67384.1"
FT                   /translation="MRRHLMALALVCTLSPLEGQADLLPTRAQIDEWLGHLGGDDRFDP
FT                   DKGIDWGVLPGPFFNPELGLGVGTAVAGLYRPDPSDTVSQNSSITLSGYLSSTGAFGLG
FT                   VRSYSFFDNDRWRIFVTGGLSDTPTYYWGQGFRAGADDDGRQKYTAQSLRLQPDVLYRV
FT                   ASQTYLGVGWSLSAMHAADVKQTDRLAQIRDGRTVFSSGPSLSLQYDSRDFVPNPHRGM
FT                   LASLRYTHYTPEAGSDTRFDNLMTRFSTYHALDATRVLAWEIDGEFTQGAVPWNMLPSL
FT                   GGDQRMRGYYQGRYRDRNLISSQLEYRQKLSWRHGVVAWAGAGTMGPNVRELGSSRWLP
FT                   TVGVGYRFAFKPGINIRLDYGIGRGSSGFYFQVGEAF"
     atgcgccgcc acctgatggc tctggcgctg gtctgtacac tttcgccact ggagggacag        60
     gcggatctgt tgccgacgcg tgcgcagatc gatgagtggc tggggcatct gggtggcgac       120
     gatcgcttcg atccggacaa ggggattgac tggggggtac tgccggggcc gttttttaat       180
     cccgagctgg ggctgggggt cggcaccgcg gtggctgggc tgtatcgccc ggatccctcg       240
     gataccgtca gccagaattc cagtattacg ctgagcggtt acctcagctc taccggcgcc       300
     tttgggctgg gagttcgcag ctacagcttt tttgacaatg atcgctggcg tatctttgtc       360
     accggtgggc tcagcgatac gccgacctac tactggggac agggcttccg cgccggggcc       420
     gatgacgatg gtcggcagaa atacacggcg cagtcgctgc ggctacagcc ggatgtgctg       480
     taccgggtag cgtctcagac atacctcggc gtcggctggt cgctgtcggc gatgcatgcc       540
     gccgatgtta agcaaacgga tcgtctggcg cagattcgcg atgggcgtac ggtattcagc       600
     tctggcccca gcctatcgct gcagtatgac agccgggact ttgtacccaa tccgcacagg       660
     gggatgttgg cgagcctacg ctacacccac tatacgccgg aagcgggcag cgatacccgc       720
     tttgataacc tgatgacccg cttcagtacc taccacgcgc tggatgcgac ccgcgtgctg       780
     gcctgggaga tcgatggtga gtttacccag ggggcggtgc cgtggaatat gctgccgtcg       840
     ctcggcggcg atcagcggat gcggggttac taccaggggc gctaccgcga tcgtaatctg       900
     attagttcgc agctggagta ccggcagaag ctgagctggc gccacggcgt ggtagcttgg       960
     gccggtgccg gtacgatggg gccaaacgtc agggagctgg gcagcagtcg ctggctgccc      1020
     accgtggggg tcggctaccg cttcgccttt aagcccggca ttaatattcg tttggactat      1080
     ggtattggcc gcggcagtag cggtttttat tttcaggtag gagaggcatt ttga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page