(data stored in ACNUC7421 zone)

EMBL: CP001600.PE122

CP001600.PE122       Location/Qualifiers
FT   CDS_pept        129223..130356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0130"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67385"
FT                   /db_xref="InterPro:IPR025130"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC94"
FT                   /protein_id="ACR67385.1"
FT                   /translation="MTAVRGLCAVLLTWCGVAGAFGLPMSLDLAPLQLQQAAHVWPVSA
FT                   PLLPPDGLRPCCAFGYDLNAEALGIPIPFYRLNNVVEADALGAHRYNDSLFGALASLAG
FT                   LGSERNGLIYTRRGGFLDLAHVRDSADMTVYIFSHLYPRLGQAFRLELGDELARRQLVL
FT                   SAFTPPHEARERYTLAAYLAARLAFEVAAWHEIAQWYGYESIPGFSEGVSAFSPEDLYS
FT                   NLLGTRLALTLILNGYTASLGQYSAALTTLLPQALCQLQAQPAVLTRFQFDMLDGKWWD
FT                   SHQAVPQKFLVLKRNYDTHADRLPTPIPGELTPPLRLMLPGQVYHYDLARLAELRLLPG
FT                   ASMKRLPAPPRYYTWRDFSHLAAFARTQDALQLSRKR"
     atgacggcgg tcaggggatt gtgtgcggtg ctgctgacct ggtgcggcgt ggccggggcg        60
     tttggcctgc cgatgagcct tgatctggcg ccgctgcagc tccagcaggc ggctcatgtc       120
     tggcccgtga gcgcgccttt gctgccgccg gatgggctgc gtccctgctg cgccttcggc       180
     tatgacctga acgctgaggc tctgggcata cccattccct tttaccgttt gaacaatgtg       240
     gttgaggcgg atgcgctggg cgctcatcgc tacaacgata gcctgtttgg cgctctggcc       300
     agccttgccg gtctgggcag cgagcgtaat ggccttatat atacgcgtcg tggtggattc       360
     ttggatttgg cacacgttcg cgatagcgcg gatatgacgg tatacatctt cagccatttg       420
     tacccgcggt tggggcaggc tttccgccta gagctgggcg acgagcttgc gcggcgtcag       480
     ctggtgctct ctgcctttac gccaccgcat gaggcgcggg agcgctacac cctcgcggcc       540
     tatttagccg cccgcctggc gtttgaggtg gcggcctggc atgagattgc ccaatggtat       600
     ggctatgagt ctattcctgg cttttcggag ggggtatcgg cgttttcccc agaggatctc       660
     tattcgaatc tgctggggac gcgactggcc ctgacgctga tcctgaatgg atatacggcc       720
     tcgctggggc aatacagtgc ggcactgacg acgttgctgc cccaggcgct gtgccagttg       780
     caggcacagc ccgccgtatt gacgcgtttt cagtttgata tgctggatgg taaatggtgg       840
     gatagccatc aggctgtccc acagaagttt ctggtgctta agcgcaacta tgatacccac       900
     gccgatcgcc tgccgacccc gattcccggg gagctgacgc caccgctgcg cctgatgctg       960
     ccggggcagg tgtaccatta tgatctggcc aggctggcgg agctgcgcct gctgccgggc      1020
     gcgtccatga aacgcctgcc cgccccgccg cgctattaca cctggcgtga cttcagtcat      1080
     ttggcggcat tcgcccggac gcaggatgcg ctgcagcttt cgcgtaagcg ttag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page