(data stored in ACNUC7421 zone)

EMBL: CP001600.PE123

CP001600.PE123       Location/Qualifiers
FT   CDS_pept        130476..131375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0131"
FT                   /product="Carboxylate/Amino Acid/Amine Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67386"
FT                   /db_xref="GOA:C5BC95"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC95"
FT                   /protein_id="ACR67386.1"
FT                   /translation="MFLLLATTLLWAFSFSLIGVYLAGQVDSWFAVLVRIALATLVFLP
FT                   FLRWRGVRPRQALAYMLVGAFQLGLMYLFYYPAFLYLTVPEVLLFTILTPLYVTLIYDL
FT                   LQGRRLRPGYLGSALLAVLGALIIRYNPLSSQFLLGFSLIQGANLCFALGQVGYKRLME
FT                   VMPLPQYRAFSWFYLGALTVALPAWWLYGNPQMLPTTSLQWGILLWLGVGASGLGYFMW
FT                   NYGATQVDAGTLAIMNNALIPAGLLVNLAIWQQHPDWFRLTLGGTVIALSLWVHRRWIV
FT                   PHPGRMAGHRRRGGAPAE"
     gtgtttctac tgctggcaac cacgctgctg tgggcctttt cgtttagtct gatcggcgtg        60
     tatttggccg gtcaggtcga tagctggttt gccgtgctgg tgcggattgc gctggcgacg       120
     ttggtctttc tcccgtttct gcgctggcgc ggggtacgtc cacgtcaggc gctggcttat       180
     atgctggtgg gcgcttttca gctggggctg atgtacctgt tctactatcc cgcgtttctg       240
     tatctgacgg tgccagaggt gctgctgttt accattctga cgccgctgta tgtcacgctg       300
     atttacgatc tgctacaggg gcgacgcctg cgcccaggct atttgggcag cgcgctgctg       360
     gcggtgctgg gcgcgctgat tatccgctat aacccgctca gttcacagtt tttactgggt       420
     ttttccctga tccagggggc caatctctgc tttgcgctgg ggcaggtggg atacaaacgt       480
     ctgatggagg tgatgccgct gccgcagtat cgcgccttct cctggtttta tctgggggcg       540
     ctgacggttg cacttccggc ctggtggcta tatggcaatc cgcagatgct gccgaccacg       600
     tcgctacagt ggggcatttt gctgtggctg ggcgtcggtg cctcggggct ggggtacttc       660
     atgtggaact atggtgctac gcaggtggat gccggtacgc tggccatcat gaacaatgcg       720
     ctgatcccgg cggggctgct ggtgaatctg gccatctggc agcagcatcc tgactggttc       780
     aggctgacgc tgggtgggac agtgatcgcc ctgtcgcttt gggtacaccg gcgctggatc       840
     gtaccacatc ccggacgaat ggcaggccat cgcaggcgtg gcggcgcgcc agctgaataa       900
//

If you have problems or comments...

PBIL Back to PBIL home page