(data stored in ACNUC7421 zone)

EMBL: CP001600.PE127

CP001600.PE127       Location/Qualifiers
FT   CDS_pept        137086..137613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0138"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67393"
FT                   /db_xref="GOA:C5BCA2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA2"
FT                   /protein_id="ACR67393.1"
FT                   /translation="MLDSLIQGTIEFVRLHQDWAVPLVFFLAFGESLAFISLLLPATVI
FT                   LFALSALLGEGGVPFVPVWLAAACGAFLGDWISYWLGYHYQHQIGHIWPLSRNPQILQR
FT                   GHRYFERWGFWGVFFGRFLGPLRAAVPLVAGICAMRQRYFQLANLLSALIWGAGILAPG
FT                   MLGIRWLGQWIG"
     gtgctagaca gccttattca aggcaccatc gagtttgtcc gcctgcatca ggactgggcg        60
     gtgccgctgg tatttttcct ggcttttggt gaatcgctgg cctttatctc ccttttactg       120
     ccggcgacgg tgatcctttt tgcgctgagc gccctgctgg gtgagggcgg cgttccgttt       180
     gttcctgtct ggttggcggc tgcgtgcggc gcctttcttg gcgactggat ttcctattgg       240
     cttggttacc attatcagca tcagatcggc catatatggc cgctgtcgcg gaatccgcag       300
     atactgcagc gtggtcaccg ttactttgaa cgctgggggt tttggggcgt attctttggc       360
     cgtttcctgg gccccctgcg ggctgccgta ccgctggtcg ccgggatctg cgccatgcgg       420
     cagcgctatt ttcagctggc caacctgctg tctgcgctga tctggggcgc ggggattctg       480
     gcaccgggta tgctgggcat ccgctggctg ggccagtgga ttgggtag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page