(data stored in ACNUC7421 zone)

EMBL: CP001600.PE128

CP001600.PE128       Location/Qualifiers
FT   CDS_pept        137716..139125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0139"
FT                   /product="RmuC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67394"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA3"
FT                   /protein_id="ACR67394.1"
FT                   /translation="MENVTLWILAASLAGMVIGWLAAALRTQQARVAHEQALGALDSQL
FT                   AAAQERIAQQQLWHEECERLNQELRAQRDVNSAQEAELREVTIRLEETRMGAEEKQRLL
FT                   LNAEQRLNVQFENLANRIFEHSGRRVEEQNRQSLDALLMPLREQLDGFRRQINDSFGQE
FT                   ARERHTLTHEIRSLQQMNAQMAREALNLTRALKGDNKMQGNWGEVVLSRVLESSGLREG
FT                   HEYHSQVSVQTEESGRMQPDVVVHLPQGKDVVVDAKMSLVAYERFFNAEDEHERELALQ
FT                   QHILSLRAHIRQLGRKDYQQLPGLRTLDYVLMFIPLEPAFLAAIERDSELISEALRHNI
FT                   MLVSPTTLLVALRTINNLWRYEYQSQNAQKIADRAAKLYDKVRLFVDDMSTLGQSLERA
FT                   QSSYRQAMNKLSHGRGNLIGQVESFRGLGVEVKRPISPALVQEACQPLQDGDPAVVSGE
FT                   VVAHHGTPSVQ"
     gtggagaacg taacgctttg gatactggcg gcatcgctgg cggggatggt tatcggttgg        60
     ttggcggcgg ccctgcggac gcagcaggcg cgggttgccc atgagcaggc gctgggcgcg       120
     ttggatagcc agctcgctgc cgcccaggag cggatagccc agcagcagct gtggcatgaa       180
     gagtgtgagc gtctaaacca ggagctacgc gctcagcgcg acgtcaatag cgcccaggag       240
     gccgagctgc gcgaggtgac gatccggctg gaggagacgc gcatgggtgc agaagagaag       300
     cagcgtctgc tgctgaacgc agagcagcgc ctgaacgtcc agtttgagaa tctggctaac       360
     cgtatatttg agcacagcgg tcgtcgggtt gaggagcaaa atcgacagag cctcgatgcc       420
     ctgctgatgc cgctgcgtga acagcttgat ggttttcgcc gccagataaa cgatagcttt       480
     ggccaggagg cccgtgagcg tcacaccttg acccacgaga tccgcagcct gcagcagatg       540
     aacgcccaga tggcacgcga ggcgcttaac ctgacgcgtg ccctgaaggg ggacaacaag       600
     atgcagggca actggggcga ggtggtactg agccgggtac tggagtcctc cggtctgcgc       660
     gaggggcatg aatatcattc tcaggttagc gtgcaaacgg aggagagcgg acgcatgcag       720
     ccggatgtgg tggtacatct gccccaggga aaagatgtgg tggtggatgc caaaatgtcg       780
     ctggtggcct atgagcgctt tttcaacgcg gaggatgagc acgagcgtga gctggcactg       840
     cagcagcata tactgtcgct gcgggctcat attcgccagc tggggcgtaa ggattatcag       900
     cagctacccg gtctgcgcac cctagactat gtgctgatgt ttatccccct cgagcccgcc       960
     tttttagcgg cgatcgagcg cgattccgag ctgattagtg aggcgctgcg tcacaatatt      1020
     atgttggtaa gtccgactac attgctggtg gctttgcgca ccatcaataa tttatggcgc      1080
     tacgagtacc aaagtcaaaa tgcacaaaaa atcgctgatc gtgccgccaa gctatacgat      1140
     aaagtgcgct tgttcgtcga tgatatgtcc actcttgggc aaagtttgga acgggctcag      1200
     tcgagttatc gccaggcgat gaacaaactg agccacgggc gtggtaacct gataggccaa      1260
     gtggaaagtt ttcgcgggct gggcgtggag gttaaacgtc cgatcagccc ggcgctggta      1320
     caagaagcct gccagccgct acaggatgga gatcccgcag tggtatccgg cgaggtggtg      1380
     gcgcatcacg ggactccttc tgtgcagtaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page