(data stored in ACNUC7421 zone)

EMBL: CP001600.PE13

CP001600.PE13        Location/Qualifiers
FT   CDS_pept        complement(12472..14541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0014"
FT                   /product="glycyl-tRNA synthetase, beta subunit, putative"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67275"
FT                   /db_xref="GOA:C5B995"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B995"
FT                   /protein_id="ACR67275.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDI
FT                   EWFAAPRRLALKVAALNAAQPDREIEKRGPAIAQAFDAEGKPTKAAEGWARGCGISVDQ
FT                   AERLSTDKGEWLLYRALQKGQRAQDLLPALVASALSRLPIPKLMRWGDSDTQFVRPVHT
FT                   VTLLLGSESIPATILGVPSDRVIRGHRFMGEAEFTLDSADQYPQILLERGKVIADYDAR
FT                   KALIKRDAEAAAARIGGVADLSDSLLEEVTSLVEWPVVLTARFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIDSKDAQQIIAGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLESVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDALPTSLVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVRLYGDKLGN
FT                   ASVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSHFRTLPEA
FT                   ATLAAANKRVSNILAKSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLAPLFADGRYQ
FT                   EALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADISVLQ"
     atgacgcaac agactttcct ggttgaaatc ggcacggaag agctgccgcc gaaagctctt        60
     cgctccctgg cgcaggcctt tgccgacaac ttccgcacag aactggataa tgccggtctg       120
     gcgcacggcg atatcgaatg gttcgccgcg ccgcgccgcc tggcgctgaa agtcgccgcc       180
     ctgaacgcgg cgcagcccga tcgcgagatc gaaaaacggg gtccggccat cgcccaagcg       240
     ttcgacgccg agggtaaacc gaccaaggcg gccgagggct gggcccgcgg ctgtggtatc       300
     agtgtcgatc aggccgagcg cctgagcacc gacaaaggcg agtggctgct ataccgcgcg       360
     ctgcaaaaag ggcagcgcgc ccaggatctg ctgcctgcgc tggtcgccag cgccctgtct       420
     cgcctgccta tccccaagct gatgcgctgg ggcgacagcg atacacagtt tgtccgcccg       480
     gtgcataccg tcaccctgct gttgggcagc gaaagcattc cggcgacgat ccttggggtg       540
     ccgtccgatc gcgtaatccg tggccaccgc tttatgggcg aagccgagtt caccctcgac       600
     agcgccgatc agtatccgca gatcctgctg gagcgcggta aggttatcgc tgactatgat       660
     gcccgcaagg cgctgatcaa gcgtgatgcc gaagccgcgg cggcccgcat cggcggcgta       720
     gccgatctga gcgatagcct gctggaagag gtcacctctt tggtcgaatg gccggtcgtg       780
     ctgaccgcca gattcgaaga gaaattcctc gcggttccgg cagaggcgct ggtatacacc       840
     atgaaaggtg accagaaata cttcccggtt tacgatgcgg caggcaagct gctgccaaac       900
     ttcatctttg tcgccaatat tgactccaag gatgcccagc agatcatcgc cggcaacgag       960
     aaggtggtgc gcccgcgtct ggccgacgcc gagttcttct tcaaaaccga ccgtaagcag      1020
     cgccttgagg acaacctgcc gcgtctggag agcgtactgt tccagcagca gctgggcagc      1080
     ctgcgtgaca agaccgatcg catcaccgcg ctggctggct ggattgccca gcagatcggc      1140
     gccgatgtca atatggcaac ccgcgcgggc ctgctttcca agtgtgatct gatgaccaac      1200
     atggtgtttg agttcaccga cacccagggg gtcatgggga tgcactatgc ccgccacgac      1260
     ggcgaggccg aagaggtcgc cgtcgccctg aacgaacaat atatgccgcg ctttgccggc      1320
     gatgcgctgc ccacctccct ggtcgcctgc gctgtcgcta ttgccgataa aatggatacc      1380
     ctggcgggga tcttcggcat cggtcagcat ccgaagggcg ataaagatcc gtttgctctg      1440
     cgccgcgccg cgctgggcgt gctgcgtatc gtcgtagaga aaaagctacc gctggatctg      1500
     ctgactctga cgcaggaggc cgtgcgcctg tacggtgaca agctgggcaa cgccagcgtc      1560
     gtcgatgacg tcgtggaatt tatgctgggc cgcttccgcg cgtggtatca ggaagagggg      1620
     catgccgttg acaccattca ggcggtgctg gcgcgccgtc cgacccgtcc ggccgacttc      1680
     gacgcccgcg tacgcgccgt cagccacttc cgtacgctgc cggaggctgc tacgctggcc      1740
     gccgccaata agcgcgtatc caatatcctg gccaaatcag gcgatgtcct ggctgaacag      1800
     gtacaggccg tcctgctgaa ggaaccggcg gaaatccgcc tggcggccaa cctgatcacg      1860
     ctgcaggaga agctggcgcc gctgttcgcc gacggccgtt atcaggaagc gctggttgag      1920
     ctggcgaccc tgcgtcaacc ggtcgatgac ttcttcgagc aggtcatggt catggccgac      1980
     gatgagcagg tccgcatcaa ccgcctgacg ctgctgaaca agctgcgcga tctgttcctg      2040
     caggtcgccg acatctccgt tctgcagtag                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page