(data stored in ACNUC7421 zone)

EMBL: CP001600.PE132

CP001600.PE132       Location/Qualifiers
FT   CDS_pept        142364..142633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0143"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67398"
FT                   /db_xref="GOA:C5BCA7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA7"
FT                   /protein_id="ACR67398.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGD
FT                   DEKTPPSNTANSSAAPQDADFKSIVEQQPEVKKEESKSQNKEQV"
     atgggcggta tcagcatttg gcagttgttg attattgcag tgatcgtggt gttgctgttt        60
     ggcaccaata agctgcgtac tctgggttcg gatctgggcg catcgatcaa gggctttaag       120
     aaagccattg gtgatgatga aaaaacgcct ccctccaaca cggcaaacag cagtgcggca       180
     cctcaggatg cagattttaa atcgatcgtt gagcagcagc ctgaagtgaa gaaagaagag       240
     tccaagagtc agaataaaga gcaggtgtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page