(data stored in ACNUC7421 zone)

EMBL: CP001600.PE133

CP001600.PE133       Location/Qualifiers
FT   CDS_pept        142637..143167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0144"
FT                   /product="twin arginine-targeting protein translocase TatB,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67399"
FT                   /db_xref="GOA:C5BCA8"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA8"
FT                   /protein_id="ACR67399.1"
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPVAVRTVAGWIRALRSLATS
FT                   VQNELSQELKLQELQDSLKKAETAGLQNLTPELKASMDELKQAAESMKRSYHSEITGSD
FT                   TEKEPSAAETIPHADMMTKPEADVALAPRQSAVQDAPPVVQAVPSTHADAMTASAQPAS
FT                   SPSTSHDSSQHGR"
     gtgtttgaca tcggatttag tgaactgctg ctggtaatgg tcatcggcct ggtggtgctt        60
     gggccggagc ggttgccggt agcggtgcgt acggtggcgg gatggatcag ggcgttgcgt       120
     tcgttggcaa cgtcggttca gaacgaactg tcgcaggaat tgaagctgca ggagttgcag       180
     gacagtctca agaaggcaga aacagccggc ttgcagaact tgacgccgga gctgaaggct       240
     tccatggatg aactgaagca ggcggctgaa tcaatgaagc gcagttatca ttcagagatc       300
     actgggtccg atacggagaa ggagccttcg gcggcggaaa cgatccccca tgcggatatg       360
     atgaccaagc cggaggctga tgtagcgcta gcgccgcgtc agagcgcggt gcaggatgca       420
     ccaccggttg tacaggcagt accctccacc cacgccgatg ccatgactgc cagtgcgcag       480
     cccgcatctt ctccttctac ctcacacgat agttcgcagc atggccgttg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page