(data stored in ACNUC7421 zone)

EMBL: CP001600.PE134

CP001600.PE134       Location/Qualifiers
FT   CDS_pept        143157..143945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0145"
FT                   /product="twin arginine-targeting protein translocase TatC,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67400"
FT                   /db_xref="GOA:C5BCA9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA9"
FT                   /protein_id="ACR67400.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNAIICILVVFLALVYFANDIYHLV
FT                   SAPLINQLPHGASMIATDVASPFFTPIKLTMIVSVFVSAPFILYQVWAFVAPALYKHER
FT                   RMLTPLLVSSTLLFYIGMAFAYFVVFPLAFGFFAKTAPAGVTIATDINNYLDFVMALFM
FT                   AFGVSFEVPVAIILLCWTGVTTPAELKKKRPYVIVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   CLLFEVGVFFARFYVGKRRRDPEEEDEDEALHDEEQPKAG"
     atggccgttg aagataccca gccgttgatt agtcatttga tcgagctgcg taagcggctg        60
     ttgaatgcga ttatttgtat cctggtggta ttcctggcat tggtctattt tgccaatgat       120
     atctatcact tggtttctgc cccgttgatc aatcagctgc cgcacggcgc cagtatgatc       180
     gcgaccgacg tggcatcccc cttctttacg ccgattaagc tgaccatgat tgtgtcggtt       240
     tttgtctccg cgccgtttat tctgtatcag gtctgggcct ttgtggcgcc ggcgctgtac       300
     aagcatgagc gccggatgct gacgccgctg ctggtctcca gtacgctgct gttctatatc       360
     ggcatggcgt ttgcctattt tgtagtcttt ccgctggcat ttggcttttt tgccaaaact       420
     gcgccggcag gagtaacgat tgctaccgat attaataact acctcgattt tgtcatggcg       480
     ctgtttatgg cgtttggcgt ctcgttcgag gtgccggttg ccatcattct gctgtgctgg       540
     accggcgtta ccactccggc agagctgaag aaaaagcggc cctacgtgat tgtcggcgcc       600
     ttcgtcgttg gcatgctgct gacgccaccg gacgtattct cgcagacgct gctggcgatc       660
     ccgatgtgtc tgctgtttga ggtcggcgtc ttctttgctc gtttctatgt cggcaaacgc       720
     cgtcgcgatc cggaagaaga ggatgaagac gaagctctgc acgatgaaga gcagcccaaa       780
     gcaggctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page