(data stored in ACNUC7421 zone)

EMBL: CP001600.PE14

CP001600.PE14        Location/Qualifiers
FT   CDS_pept        complement(14551..15459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0015"
FT                   /product="glycyl-tRNA synthetase, alpha subunit, putative"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67276"
FT                   /db_xref="GOA:C5B996"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B996"
FT                   /protein_id="ACR67276.1"
FT                   /translation="MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFAC
FT                   FEQYEKEARMLLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   MVAEAYYASREALGFPMCKKD"
     atgcaaaagt ttgatatcaa gacctttcag gggctgatcc tgactctgca ggactattgg        60
     gcgcgccagg gctgcaccat cgtccaaccg ctggacatgg aagtcggcgc cggcacctcc       120
     catccgatga cctgcctgcg agcgcttggc ccagagccga tggctaccgc ctatgtacaa       180
     ccgtcccgcc gtccaaccga tggccgctac ggcgaaaacc cgaaccgact gcagcattac       240
     taccagtttc aggttgtgat caagccgtct ccggacaaca ttcaggaact gtacctgggc       300
     tcactcaaag cgctggggct ggatcccacc gtgcatgata tccgctttgt cgaggataac       360
     tgggaaaacc cgaccctggg cgcctggggc cttggctggg aagtctggct caacggtatg       420
     gaagtcaccc agttcaccta cttccagcag gtgggcggcc tggagtgtaa gccggttacc       480
     ggtgaaatca cctacggctt agagcgtctg gccatgtata tccagggtgt cgatagcgtc       540
     tacgacctgg tgtggagcga tggcccgctg ggtaaaacca cctacggcga cgtgttccac       600
     cagaacgaag tggaacagtc cacctataac ttcgaatacg ctgacgtcga tttcctgttc       660
     gcctgctttg aacagtacga aaaagaagcc cgcatgctgc tggagctgga gcacccgctg       720
     ccgctgccgg cctatgagcg cattctgaag gctgcccata gcttcaacct gctggatgcc       780
     cgtaaagcga tctcggtaac cgagcgccag cgctacatcc tgcgcatccg caccctgacc       840
     aaaatggtcg ccgaagccta ctacgcctcc cgcgaggcgc tgggcttccc gatgtgtaaa       900
     aaagattaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page