(data stored in ACNUC7421 zone)

EMBL: CP001600.PE140

CP001600.PE140       Location/Qualifiers
FT   CDS_pept        149113..149814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0151"
FT                   /product="oxidoreductase, FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67406"
FT                   /db_xref="GOA:C5BCB5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB5"
FT                   /protein_id="ACR67406.1"
FT                   /translation="MTTLSCKVTSVDAITDTVYRVRLVPERAVDFRAGQYLMVVMDERD
FT                   KRPFSMASTPLQSDCIELHIGASELNLYAMAVMDRILQDRTLCVDMPHGDAWLREDSLR
FT                   PLVLIAGGTGFSYTRSILLMALSQQPQREISLYWGGRELKHLYDLNELYALSARYPQLK
FT                   IIPTVEQPDADWQGRSGTVISAVMQDFGSLAQHDIYIAGRFEMAKIARERFCAEREANP
FT                   EHIYGDAFAFI"
     atgacaacgt tgagctgtaa agttacttca gtagatgcca tcacggatac cgtgtaccgc        60
     gtacgtctgg taccggagcg tgccgtcgat tttcgcgccg gtcaatacct gatggtcgtg       120
     atggatgagc gggataagcg cccgttctct atggcatcca cgccgctgca gagcgattgc       180
     attgaactgc acatcggtgc ttcggagctt aatctctacg ccatggccgt catggatcgc       240
     atcctgcagg atcgcacgct gtgcgtcgat atgcctcatg gcgatgcctg gctgcgcgaa       300
     gatagcctgc gcccgctggt gctgatcgcc ggcggcaccg gtttctccta tacccgctcg       360
     attctgctga tggcgctgtc tcagcagccg cagcgggaga tctctctcta ttggggcgga       420
     cgcgagctga agcatctgta tgatctcaat gagctgtatg cgctgagtgc gcgctatccc       480
     cagctgaaga taatcccgac cgtagagcaa ccggatgccg attggcaagg gcggagcggt       540
     acggtgatca gcgccgtgat gcaggacttt ggctcattgg cccagcacga tatctatatc       600
     gccggacgtt tcgagatggc taagattgcc cgggagcgct tctgtgccga gcgtgaggcc       660
     aatccagagc atatttacgg cgatgccttt gcctttatct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page