(data stored in ACNUC7421 zone)

EMBL: CP001600.PE142

CP001600.PE142       Location/Qualifiers
FT   CDS_pept        151288..151902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0153"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67408"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB7"
FT                   /protein_id="ACR67408.1"
FT                   /translation="MPHPYPVPAQPVSVCEEIKKSRFITLLAHTPGVDAAKAFVQETRR
FT                   AHPDARHHCWAFVAGAPEDTQRLGFSDDGEPSGTAGKPMLAQLMGSGVGEVCAVVVRYY
FT                   GGIKLGTGGLVRAYGSGVQQALQALVRRQKVPMAAYTLCCDYAQLTLVEGIVAQAGGSV
FT                   LDSAFSAQVMLRLSLPLGRQDDVDEKLRNASRGTLQLQATS"
     atgccgcatc cgtaccccgt tcccgcgcag cccgtcagcg tctgtgagga gatcaagaaa        60
     agccgcttca ttacgctgct ggctcacacg ccgggggttg acgcggcgaa ggcgttcgtt       120
     caggagaccc gacgggcaca ccctgatgca cgccatcact gctgggcctt cgtggccggt       180
     gcgccggagg atacccaacg gctgggtttt tcagatgacg gtgaaccctc cggcacggcg       240
     gggaaaccca tgctggctca gctgatgggc agcggcgtag gcgaggtgtg tgcggtcgtc       300
     gtgcgttact acggcgggat caagttgggc accggcggat tggtcagggc ctacggcagc       360
     ggagttcagc aggcgttgca ggcgctggtc cgtcggcaaa aggtgccgat ggcagcgtat       420
     acgctgtgct gtgactatgc ccaactgacg ctggtggagg ggattgtggc gcaggcgggc       480
     ggtagcgtgc ttgacagcgc gttttctgct caggtgatgc tgcggctgag cctgccactt       540
     ggccgtcagg acgatgtgga tgaaaaattg cgcaacgcca gtcgtggaac attgcaatta       600
     caggcgactt cgtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page