(data stored in ACNUC7421 zone)

EMBL: CP001600.PE143

CP001600.PE143       Location/Qualifiers
FT   CDS_pept        151955..153406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0154"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67409"
FT                   /db_xref="GOA:C5BCB8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB8"
FT                   /protein_id="ACR67409.1"
FT                   /translation="MHFRAIIRIVGLLVILFSGTMFVPGLVALIYRDGAGRAFVETFFV
FT                   ALGIGMLLWWPQRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSVTDAFFE
FT                   SFSGLTTTGATTLVGLDALPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGLQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVMLTIACAIALWGAGMDVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIAVFLLISGCNFSLHFAFLSGRSPRVYWRDPEFRMFIAVQ
FT                   LTLVSVCTLVLWLHNVYASGWQTFNQAFFQVVSMATTAGFTTDSIAKWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFIISMLAIIATGVDDFSAFAAVVATLNNLGPGLGVVADNFTSMNDVAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRN"
     atgcattttc gcgccatcat tcgaatcgtc ggcctgctgg tcatcctgtt ttccggcacc        60
     atgtttgtcc ccggactggt ggcgctgatc taccgcgatg gcgccgggcg tgcgtttgtc       120
     gaaacgtttt ttgtcgccct cggcatcggt atgctgctgt ggtggcccca gcgtaaacag       180
     aagcatgagc tgaagccgcg cgaggggttt ctgatcgtcg tgctgttttg gaccgtgctg       240
     ggcagcgttg gtgcgctacc gtttctgttt tcagaacgtc cgaatcttag cgtcacagat       300
     gcgtttttcg agtcgttttc cggcttgacc acgaccggcg ccacaacgct ggtcgggcta       360
     gacgcgctgc ctaaggcgat actgttctat cggcagatgc tacagtggct cggcggtatg       420
     gggatcattg tgctggcagt ggccattctg cccattcttg gcgtcggtgg cctgcagcta       480
     taccgggccg agatgccggg ccctcttaaa gacaacaaga tgcgcccgcg tattgccgaa       540
     acggccaaaa cgctgtggct tatctatgtc atgctgacca tcgcctgtgc catcgccctg       600
     tggggggcgg gaatggatgt gtttgacgcg atttcgcaca gtttttcgac gattgccatc       660
     ggcgggtttt caacccatga cgccagcatc ggctatttca acagtccgac cattaacacc       720
     atcatcgccg tttttctgct gatttccggg tgtaacttta gcctgcactt tgcctttctc       780
     agtgggcgca gtccccgggt gtattggcgc gatccggagt tcaggatgtt catcgccgtg       840
     cagctgacgc tggtcagcgt ctgtacgctg gtcctgtggc tgcataatgt atacgccagc       900
     ggatggcaaa cgttcaatca ggcctttttc caggtggtct cgatggcgac taccgccggt       960
     ttcaccaccg acagcattgc caaatggccg ctgtttttac ccgtgctgct gctgtgctct      1020
     gcgtttatcg ggggctgcgc tggctctacc ggcggtgggc ttaaggtgat ccgtattctg      1080
     ctgctgttcc tacaggggtc acgtgagctc aagcggctgg tgcaccccaa tgcggtatat      1140
     accatcaagc tgggaaatcg cgccctgccg gagcggattc tggaggccgt ctggggattc      1200
     ttttcagcct atgcgctagt gtttatcatc agcatgctgg cgatcattgc gaccggagtc      1260
     gacgatttct ctgcctttgc ggcggtggtc gcaaccttaa ataaccttgg ccccgggctg      1320
     ggggtcgtgg cggataactt cacctcaatg aatgatgtcg ctaaatggat cttggtggtg      1380
     accatgctgt ttggccgtct ggaggtgttt acattattgg tgctgtttac gccaactttt      1440
     tggcgcaact ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page