(data stored in ACNUC7421 zone)

EMBL: CP001600.PE144

CP001600.PE144       Location/Qualifiers
FT   CDS_pept        153424..153972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0155"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67410"
FT                   /db_xref="GOA:C5BCB9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB9"
FT                   /protein_id="ACR67410.1"
FT                   /translation="MKTLVLYSSHDGQTKAIATAIATAISETLDCELRDLEQAGDIDLN
FT                   AYQAVAIGAAVRYGHFPRALHRFASDHTPRLNTMPSAFFAINLTARKPEKRTPQTNGYT
FT                   RKFLLSTPWKPAQCVVFAGALRYPRYSWLDRTMIKMIMKMTGGETDTTKEVEYTDWQQV
FT                   DRFARDFARFVSTLAKKTP"
     atgaaaacgt tagtgctgta ttcgagccac gatggacaaa ctaaagcgat cgctaccgcg        60
     attgcgacgg cgatatctga gacgttggac tgtgagctgc gggatttaga acaggcgggc       120
     gatattgacc tgaacgccta ccaggcggtg gcgattggcg ctgcggtgcg ctatggtcac       180
     tttccccgcg cgctgcaccg ctttgccagt gaccataccc cgcggctgaa tacgatgccg       240
     agtgcatttt ttgccattaa cctgacggcg cgcaagccag agaagcgaac cccgcagacg       300
     aacggctata cgcgtaagtt tttgctgtcg acgccatgga aacccgccca gtgcgtggta       360
     tttgccggcg cgctgcgcta tccgcgttat agctggctgg atcgcaccat gattaagatg       420
     attatgaaga tgaccggcgg tgagaccgat acgacaaaag aggtcgagta cacggactgg       480
     caacaggtcg atcgttttgc ccgtgatttt gctcgcttcg tgagcacgtt agctaaaaaa       540
     actccataa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page