(data stored in ACNUC7421 zone)

EMBL: CP001600.PE146

CP001600.PE146       Location/Qualifiers
FT   CDS_pept        160698..161657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0161"
FT                   /product="bifunctional protein BirA , putative"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67413"
FT                   /db_xref="GOA:C5BCC2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC2"
FT                   /protein_id="ACR67413.1"
FT                   /translation="MKDITVPLKLISQLADGDFHSGEHLGESLGMSRAGINKHIQTLRD
FT                   WGIDVFTVPGKGYCLPTPMQLLNTETIGALLPQGRVTVLPVVDSTNQYLLERIGELASG
FT                   DACVAEYQQAGRGRRGRHWFSPFGANLYLSMYWRLEQGPAAAMGLSLVIGIVMAEVLQA
FT                   LGAAGVKVKWPNDLYLNDRKLAGILVELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQ
FT                   WINLQEAGVNIDRNQLVACLLSRLRSTLADFEVRGLSPFISRWRVLDNFVDRPVRLIIG
FT                   EQVIHGIARGIDAQGALLLERDGVITPFIGGEISLRAG"
     atgaaagata ttacggttcc actgaaactg atttcgcaat tggccgatgg cgattttcac        60
     tccggtgagc acttaggtga gtcactggga atgagccgag cagggatcaa taagcatatt       120
     cagactctgc gagactgggg gattgacgta ttcaccgttc cagggaaggg ttattgtctg       180
     ccgacgccca tgcagttact gaatacggag acgatcggtg ccctgctgcc ccaggggcgg       240
     gtgaccgtgc tgccggtggt cgattccacc aatcagtact tgttggagcg aattggcgag       300
     ctggcctccg gtgacgcctg cgtcgcagag tatcagcagg ctgggcgcgg tcgccgcggt       360
     cgtcactggt tttcaccctt cggcgcaaac ctgtatttat ccatgtactg gaggctggag       420
     caggggcctg ccgctgcaat ggggctgagc ctggtgatcg ggatcgttat ggcagaggtc       480
     ttgcaggcgc tgggtgctgc cggtgtgaag gtcaagtggc cgaatgacct ctatcttaac       540
     gatcgtaagt tggctggtat tctggttgag ctgacgggga aaacgggtga tgcggcgaac       600
     attgtggttg gtgccgggat caatctgatg atgcgcaatc cggataccag cgtcgtggat       660
     cagcagtgga tcaacttaca ggaggccggg gtgaacatcg atcgcaatca gctggtagcc       720
     tgtttactga gccgtctgcg cagcacgctg gccgattttg aggtgcgcgg tttatcaccg       780
     tttatctccc gttggcgggt gctggataac tttgttgacc gtccggtacg gctgatcatc       840
     ggggagcagg tgatccacgg cattgctcgg ggcatcgatg cgcagggtgc gctgctgctg       900
     gagcgcgacg gcgttatcac cccgtttatc ggtggtgaga tctccttacg cgcaggctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page