(data stored in ACNUC7421 zone)

EMBL: CP001600.PE147

CP001600.PE147       Location/Qualifiers
FT   CDS_pept        complement(161732..162679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0162"
FT                   /product="pantothenate kinase, putative"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67414"
FT                   /db_xref="GOA:C5BCC3"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC3"
FT                   /protein_id="ACR67414.1"
FT                   /translation="MKKEQSLATPYLQFDRHQWAALRNSVPLTLTEEEIARLKGINEDL
FT                   SLDEVAQIYLPLSRLLNFYFSSSVSRQVVLEKFLGTHSPRIPYIIGIAGSVAVGKSTTA
FT                   RVLQALLSRWPEHRRVELITTDGFLHPNKILQERGLMKKKGFPQSYDMHHLVKFVSDIK
FT                   SGVSQVTAPQYSHLIYDVLPDSRKLIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDFV
FT                   DFSIYVDADEHQLQAWYINRFLKFREGAFSNPDSYFHHYSQLPESEAIAIATGLWNEIN
FT                   GLNLRQNILPTRERASLIMTKGSNHAIESVRLRK"
     atgaagaaag agcaatccct ggcgaccccc tatctgcagt ttgatcgcca tcagtgggcg        60
     gcattgcgta attccgtccc attaactctc accgaagaag agattgcccg tctcaaaggg       120
     ataaatgaag atctctcgct ggatgaggtt gcccagatct atttgcccct ttcacgcttg       180
     ctgaatttct atttcagctc cagcgtcagt cgacaggtcg tgctggagaa gttcctcggc       240
     acccatagcc cgcgcatccc ctatattatc ggcattgcag gcagcgtcgc ggtcggcaag       300
     agcacgacgg cccgcgtatt gcaggcgctg ctcagtcgtt ggccggagca tcgccgggtc       360
     gagctgatca ccaccgacgg gttcctgcat cccaataaaa tactgcaaga acggggactg       420
     atgaaaaaga aaggctttcc ccagtcctac gatatgcacc atctggtaaa gtttgtatca       480
     gatataaaat caggcgtgtc gcaggtaacc gccccccagt actctcacct aatttacgat       540
     gtgctcccgg acagccgtaa attgattgag caaccagata ttctgatctt ggaagggctg       600
     aacgtactgc aaagtgggat ggactatccg cacgatccgc accgggtatt cgtatccgac       660
     tttgtcgact tctccattta tgttgatgct gatgaacatc agctgcaggc ctggtacatc       720
     aaccgctttc tcaagttccg cgagggcgcc ttctccaacc cggactctta cttccatcat       780
     tactcacagc tgccagagtc tgaggccatc gcgattgcca ctgggctatg gaatgaaatt       840
     aacggattaa acctgcgtca gaatattcta ccaacccgcg agcgggccag tctcattatg       900
     accaagggca gcaaccacgc cattgagagc gtccgactgc gcaaatag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page