(data stored in ACNUC7421 zone)

EMBL: CP001600.PE15

CP001600.PE15        Location/Qualifiers
FT   CDS_pept        complement(15505..15630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67277"
FT                   /db_xref="UniProtKB/TrEMBL:C5B997"
FT                   /protein_id="ACR67277.1"
FT                   /translation="MRPRPALMRYFARKIRNSGACGLKKRALSHYCCISYAQAVY"
     gtgcgtccgc gcccggcgct gatgcgatat tttgcacgta aaatccgcaa tagcggcgcc        60
     tgcgggctaa aaaagcgcgc cttgtcgcac tattgctgta tatcttacgc tcaggcggta       120
     tactga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page