(data stored in ACNUC7421 zone)

EMBL: CP001600.PE151

CP001600.PE151       Location/Qualifiers
FT   CDS_pept        166276..166704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0170"
FT                   /product="50S ribosomal protein L11, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67418"
FT                   /db_xref="GOA:C5BHE0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE0"
FT                   /protein_id="ACR67418.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKDKVGKVTRA
FT                   QVREIAETKAADMTGADVEAMARSIEGTARSMGLVVED"
     atggccaaga aagtccaagc ctacgtgaag ctgcaggttg cagccggtat ggctaacccg        60
     agcccgccag tcggtccggc tctgggtcag cagggtgtta acatcatgga attctgtaag       120
     gcgttcaatg ctaagactga cagcattgaa aaaggtctgc cgattccggt tgttattacc       180
     gtttactctg accgttcttt cactttcgtc accaagaccc cgccagctgc cgttctgctg       240
     aagaaagctg ctggtgtcaa gtctggttcc ggtaagccga acaaagacaa ggtcggtaaa       300
     gtgacccgtg ctcaggtacg tgaaatcgca gaaactaaag ctgcggacat gactggtgct       360
     gacgttgagg cgatggctcg ctcaatcgaa ggtaccgctc gttccatggg cctggtagtg       420
     gaggactaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page