(data stored in ACNUC7421 zone)

EMBL: CP001600.PE152

CP001600.PE152       Location/Qualifiers
FT   CDS_pept        166708..167412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0171"
FT                   /product="50S ribosomal protein L1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67419"
FT                   /db_xref="GOA:C5BHE1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE1"
FT                   /protein_id="ACR67419.1"
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAVALLQELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRTVRVAVFTQGPNAEAAKAAGADLVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHSTIGKASFSAEQLKENLEALMVALKKAKPATAKGVYIKKVCLSTTMGAGV
FT                   TIDQATLSAVAN"
     atggctaagc tgaccaagcg catgcgcgtg atccgtgaga aagttgatgc gactaaacag        60
     tacgatatca acgaagccgt tgctctgttg caagagctgg ccaccgccaa attcgttgaa       120
     agcgtagacg ttgccgttaa cctcggcatc gatgcgcgta aatctgacca gaacgtacgt       180
     ggtgctactg tcctgccgca cggcaccggc cgcaccgtac gcgttgctgt ctttacccag       240
     ggtccgaacg ctgaagcggc taaagctgct ggcgctgacc tggtaggtat ggaagacctg       300
     gccgatcaga tcaagaaagg cgagatgaac ttcgacgttg ttattgcttc cccggatgca       360
     atgcgcgttg ttggtcaact gggccagatc ctggggccgc gtggcctgat gccgaacccg       420
     aaagtgggta ccgttactcc gaacgtagcc gaagcggtta agaacgctaa ggctggccag       480
     gttcgttatc gtaacgacaa gaacggtatc attcatagca ccatcggtaa ggcgagcttc       540
     tctgctgagc agttgaagga aaacctggaa gcgctgatgg ttgccctgaa gaaggcgaag       600
     ccggcaactg ccaaaggcgt ctacatcaaa aaagtttgcc tgtccaccac catgggcgct       660
     ggcgtaacga ttgatcaggc taccctgagc gcagtggcta actaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page