(data stored in ACNUC7421 zone)

EMBL: CP001600.PE153

CP001600.PE153       Location/Qualifiers
FT   CDS_pept        167729..168226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0172"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67420"
FT                   /db_xref="GOA:C5BHE2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE2"
FT                   /protein_id="ACR67420.1"
FT                   /translation="MALNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
     atggcattaa atcttcaaga caaacaagcg attgttgctg aagtcaccga agtagccaaa        60
     ggcgcgctgt ctgctgtcgt tgcggattcc cgcggcgtaa ccgtagacaa aatgaccgaa       120
     ctgcgtaaag caggtcgtga agctggcgta tacatgcgtg ttgttcgcaa caccctgatg       180
     cgccgcgtcg ttgaaggttc tcagtttgag tgcctgaaag acacgtttgt tggtccgacc       240
     ctgattgcat tctctatgga acacccgggc gctgccgctc gtctgttcaa ggcttttgcc       300
     aaagacaatg caaaatttga ggtcaaagct gcagcctttg aaggtgagct gatcccggcg       360
     gcccagatcg accgtctggc aactctgccg acttacgaag aagcaatcgc acgcctgatg       420
     gcgaccatga aagaagccgc tgccggcaaa ttggtccgta ctctggctgc tctgcgcgat       480
     cagaaagaag ctgcttaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page