(data stored in ACNUC7421 zone)

EMBL: CP001600.PE154

CP001600.PE154       Location/Qualifiers
FT   CDS_pept        168993..173021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0174"
FT                   /product="DNA-directed RNA polymerase, beta subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67421"
FT                   /db_xref="GOA:C5BHE3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE3"
FT                   /protein_id="ACR67421.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALDFTTEQILD
FT                   LFFDKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VTLIEVPVEYIVGKVAAKDYIDESTGELICAANMELSLDLLAKLSQSGYKRIDTLFTND
FT                   LDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLMRDEIEGSGILSKNDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDMLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGIVTDEIHYLSAIEEGNFVIAQANSNLDDEGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGMVQYVDASRIVIKVNEDEMFPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTSIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHDVLVAGGVEAEKL
FT                   EKLPRDRWLELGLADEAKQNQLEQLAEQYDELKAEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGDNTRQQVDLNTFSD
FT                   DEVLRLAENLKKGLPVATPVFDGAKEREIKGLLELGGIPTSGQITLYDGRTGERFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGSHQMEPGMPESFNVLLKEIRSLGINIELEDE"
     atggtttact cctataccga gaaaaaacgt attcgtaagg actttggtaa gcgtccccaa        60
     gtgctggacg taccatacct cctttctatc cagcttgact cgttccagaa gtttatcgag       120
     caagatccgg aaggtcagta cggtctggaa gcggctttcc gctccgtatt cccgatccag       180
     agctacagcg gcaactccga gctgcagtat gtcagctatc gcctaggtga gccggtattt       240
     gatgtcaaag agtgtcagat ccgcggcgta acctattctg ctccgctgcg cgttaagttg       300
     cgtctggtga tctacgagcg tgaggcgccg gaaggcaccg ttaaagacat caaagaacaa       360
     gaagtttaca tgggtgaaat cccgctgatg accgaaaatg gtactttcgt catcaacggc       420
     accgagcgtg ttatcgtgtc tcagctgcac cgcagcccgg gcgtattttt cgacagcgac       480
     aagggtaaaa cccactcttc aggtaaggtg ctgtataacg cacgcatcat tccttaccgc       540
     ggttcctggc tggactttga gttcgacccg aaagacaacc tgtttgtccg tattgaccgt       600
     cggcgtaagc tgccggctac catcatcctg cgcgcgctgg atttcactac cgagcagatc       660
     ctcgatctgt tcttcgataa ggtgatcttt gaaatccgcg acaataagct gcagatggag       720
     ctggtgccgg agcgtctgcg cggtgagacc gcctcttttg atatcgaggc caacggtaag       780
     gtctacgttg agaaaggccg ccgtattact gcccgccata tccgtcagct ggaaaaagat       840
     gacgttacgc tgatcgaagt accggttgag tatattgtcg gtaaagtggc tgccaaagat       900
     tacatcgacg agagcaccgg tgagctgatt tgtgccgcca acatggagct gtcgctggat       960
     ctgctggcca agctgagcca gtctggttac aagcgtatcg acacgctgtt caccaacgac      1020
     ctggatcacg gcccgtatat gtccgagacc ctgcgcgtcg atccgaccaa cgatcgtctg      1080
     agcgcgctgg tagaaatcta ccgcatgatg cgcccgggcg agccgccaac ccgcgaagcc      1140
     gccgagaatc tgttcgagaa cctgttcttc tccgaggatc gctacgatct ctctgcggtt      1200
     ggccgcatga agttcaaccg ttctctgatg cgcgatgaga tcgaaggttc cggtatcctg      1260
     agcaaaaacg acatcatcga ggtgatgaag aagctcattg atatccgtaa cggtaaaggc      1320
     gaagtcgacg atatcgacca cttgggcaac cgtcgtatcc gctctgtggg tgagatggcg      1380
     gaaaaccaat tccgtgtggg tctggtacgt gttgagcgtg cggtgaaaga gcgtctgtcc      1440
     ctgggcgatc tggatatgct gatgccgcag gatatgatca acgccaagcc gatttcggcg      1500
     gcggtgaaag agttctttgg ctccagccag ctgtcccagt ttatggacca gaacaacccg      1560
     ctgtccgaga tcactcacaa gcgtcgtatc tccgcgttgg gcccaggcgg tctgacccgt      1620
     gagcgtgccg gctttgaagt gcgagacgta cacccgaccc actacggtcg cgtatgtcct      1680
     atcgaaacgc cggaaggtcc gaacatcggt ctgatcaact ccctgtctgt gtacgcacag      1740
     accaacgagt atggtttcct ggaaactccg tatcgccgcg tgcgtgacgg tatcgtgacc      1800
     gacgagatcc attacctgtc tgccatcgaa gaaggcaact tcgttatcgc ccaggcgaac      1860
     tccaacctgg atgatgaagg ccgctttgta gaagatctgg ttacctgtcg cagcaagggc      1920
     gaatccagcc tgttcagccg tgaccaggtc gactacatgg acgtttccac ccagcaggtg      1980
     gtttccgtcg gtgcgtccct gattccgttc ctggaacacg atgatgccaa ccgtgccctg      2040
     atgggtgcga acatgcagcg tcaggccgtg ccgaccctgc gcgccgataa gccgctggtt      2100
     ggtaccggta tggagcgcgc cgttgcggtt gactccggtg taacctccgt tgccaagcgc      2160
     ggcggtatgg tgcagtacgt ggatgcgtcc cgtatcgtca tcaaggttaa cgaagatgag      2220
     atgttcccgg gcgaagctgg catcgacatc tacaacctga ccaagtacac ccgttccaac      2280
     cagaacacct gtatcagcca gatgccgtgt gtctcgctgg gtgagccgat tgagcgcggc      2340
     gacgtgttgg ccgacggccc gtccaccgat ctgggtgagc tggcgctggg tcagaacatg      2400
     cgcgtggcgt tcatgccgtg gaacggctac aacttcgaag actccatctt ggtctccgag      2460
     cgcgtggtac aggaagatcg ctttacctct atccatattc aggagctggc ctgtgtgtcc      2520
     cgtgacacca agctggggcc ggaagagatc accgccgata tcccgaacgt cggtgaagcg      2580
     gcgctctcca agctcgatga atccggtatt gtgtatatcg gcgccgaagt gaagggtggc      2640
     gacatcctgg tcggtaaggt aacgccgaaa ggtgaaaccc agctgacgcc ggaagagaag      2700
     ctgctgcgcg ccatcttcgg tgagaaggcg tctgacgtga aagactcttc tctgcgtgtg      2760
     ccgaacagcg tttccggtac cgttatcgac gtacaggtct ttacccgcga tggcgtggaa      2820
     aaagacaagc gtgcgctgga aatcgaagag atgcagctca agcaggccaa gaaagacctg      2880
     accgaagagt tgcagatcct ggaagccggt ctgtttgccc gtatccacga cgtgctggtt      2940
     gccggtggcg tggaagcgga aaaactggaa aaactgccgc gtgaccgttg gctggagctg      3000
     ggcctggccg atgaagccaa gcagaaccag ctggagcagc tggccgagca gtacgatgag      3060
     ctgaaggctg agttcgagaa gaaactggaa gccaagcgtc gtaagatcac ccagggcgac      3120
     gatctggcac cgggcgtgct gaagatcgtt aaggtgtacc tggcggtgaa acgtcagatc      3180
     cagccgggcg ataagatggc tggtcgtcac ggtaacaagg gtgttatctc taagatcaac      3240
     ccgatcgaag atatgcctta cgatgagaac ggcacgccgg tcgatatcgt actgaacccg      3300
     ctgggcgtac cgtcacgtat gaacatcggt cagatcctgg aaacccacct gggtatggcg      3360
     gcgaaaggca tcggcgacaa gatcaacgcc atgctcaagc agcagcagga agtggccaaa      3420
     ctgcgtgagt tcatccagag agcctacgat ctgggtgaca acacccgtca gcaggtggat      3480
     ctgaacacct ttagcgatga cgaagttctg cgtctggcgg aaaacctgaa gaagggtctg      3540
     ccggttgcaa cgccagtgtt cgacggtgct aaagagcgcg aaatcaaggg cctgctggag      3600
     ctgggtggta tcccgacctc tggccagatc accctgtatg atggccgcac cggtgagcgt      3660
     ttcgagcgtc aggtaaccgt gggttacatg tacatgctga aactgaacca cttggtcgac      3720
     gacaagatgc atgcgcgttc caccggctcc tacagcctgg ttacccagca gccgctgggt      3780
     ggtaaggcgc agttcggtgg tcagcgcttc ggggagatgg aagtgtgggc gctggaagct      3840
     tacggcgccg cctacaccct gcaggaaatg ctcaccgtta agtctgatga cgtgaacggc      3900
     cgtaccaaga tgtataagaa catcgtggat ggcagccatc agatggaacc gggcatgccg      3960
     gaatccttca acgtactgtt gaaagaaatc cgctcgctgg gcatcaacat cgagctggaa      4020
     gacgagtaa                                                              4029
//

If you have problems or comments...

PBIL Back to PBIL home page