(data stored in ACNUC7421 zone)

EMBL: CP001600.PE155

CP001600.PE155       Location/Qualifiers
FT   CDS_pept        173101..177321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0175"
FT                   /product="DNA-directed RNA polymerase, beta' subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67422"
FT                   /db_xref="GOA:C5BHE4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE4"
FT                   /protein_id="ACR67422.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKGMDLEAECEQLREELGETNSETKRKKLTKRIK
FT                   LLEAFILSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITQYSKSADGEMVPNTGLIDTTVGR
FT                   AILWMIVPKGLPYSIVNQPLGKKAISKMLNACYRALGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSSETVINRDGEEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVLKPGTADILVPRNTLLNEKWCDL
FT                   LEEHSVDSVKVRSVVSCETDFGVCAHCYGRDLARGHLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGNLKLSNAKFVVNSDGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGATLAKGDSAEVNGGETVANWDPHTMPVITEVSGFIRFADMIDGQTVTR
FT                   QTDELTGLSSQVVLDSAERTGSGKDLRPALKIVDANGDDVLLPGTDMPAQYFLPGKAIV
FT                   QLEDGIAISAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGVVSFG
FT                   KETKGKRRLVITPLDGSDTYEEMIPKWRQLNVFEGERVERGDVISDGPESPHDILRLRG
FT                   VNAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIANAGSSEFLEGEQVEVSR
FT                   VKIANRLLESDGKIAATYMRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRSTDTSSAPQVSAEEASANLAELLNAGLLG
FT                   GNDE"
     gtgaaagact tactgaagtt tctgaaagcg caaactaaga ccgaagagtt tgacgcgatc        60
     aaaattgcgc tggcttcgcc agacatgatc cgttcctggt ctttcggcga agttaagaag       120
     ccggaaacca tcaactaccg tacgttcaag ccggaacgtg acggtctttt ctgcgcccgt       180
     atttttgggc cggtgaaaga ttacgagtgc ctgtgcggta agtacaagcg cttgaaacac       240
     cgtggcgtca tctgtgaaaa atgtggcgtt gaagtgaccc agaccaaggt gcgccgtgag       300
     cgcatgggtc acatcgaact ggcctcaccg accgcgcaca tctggttcct gaagtccctg       360
     ccgtcccgta tcggtctgtt actggacatg ccgctgcgtg acatcgaacg cgtactgtac       420
     ttcgaatctt atgtcgtcgt cgaaggcggg atgaccaacc tggagcgtcg tcagatcctg       480
     actgaagagc agtatctgga cgcactggaa gagttcggtg acgaattcga cgccaagatg       540
     ggcgccgagg cgatccaggc tctgctgaaa gggatggatc tggaagccga gtgcgagcag       600
     ctgcgtgaag agctgggtga gaccaactcc gagaccaagc gtaagaagct gaccaagcgc       660
     atcaagctgc tggaagcgtt cattctgtct ggcaacaagc cggagtggat gatcctgacc       720
     gtgctgccgg tattgccgcc ggatctgcgt ccgctggttc cgctggacgg cggtcgtttc       780
     gcgacctccg atctgaacga tctgtaccgt cgggtgatca accgtaacaa ccgtctgaag       840
     cgtctgctgg atctggctgc gccggatatc atcgtacgta acgaaaagcg tatgttgcag       900
     gaagcggtcg atgcgctgtt agataacggc cgtcgcggtc gtgccatcac gggctccaac       960
     aagcgtccgc tgaagtctct ggccgacatg atcaagggta agcagggtcg cttccgtcag      1020
     aacctgctgg gtaaacgcgt cgactattcc ggtcgttccg ttatcaccgt aggtccatac      1080
     ctgcgcctgc atcagtgcgg tctgccgaag aagatggcac tggagctgtt caagccgttc      1140
     atctatggca agctggagct gcgtggtctt gctaccacca tcaaagcggc caagaagatg      1200
     gtcgagcgtg aagaagccgt ggtgtgggat atcctcgatg aggtgatccg cgagcatccg      1260
     gtgatgctga accgtgcgcc gaccctgcac cgtctgggta tccaggcgtt cgaaccgctg      1320
     ctgatcgaag gtaaggccat tcagctgcac ccgctggtgt gtgcggcata caacgccgac      1380
     ttcgatggtg accagatggc ggtacacgta ccgttgacgc tggaagccca gctggaagcg      1440
     cgtgcgctga tgatgtccac caacaacatc ctctccccgg cgaatggcga tccgatcatc      1500
     gttccgtctc aggacgtagt attgggtctg tactacatga cccgtgactg cgtgaacgcc      1560
     aaaggcgaag gcatggtgtt gagcggcccg aaagaggccg agcgtattta tcgcgccggt      1620
     ctggcgtcgc tgcatgcccg cgttaaagtg cgtatcaccc agtacagcaa aagtgccgat      1680
     ggcgagatgg ttccgaacac cggacttatc gacaccaccg ttggccgcgc catcctgtgg      1740
     atgatcgtac cgaaaggtct gccgtactct atcgttaacc agccgctggg caagaaagcc      1800
     atctccaaga tgctgaacgc ctgctaccgc gcgctgggtc tgaagccgac cgttatcttc      1860
     gctgaccaga tcatgtatac cggtttcgcc tatgcggcgc gctccggtgc gtctgtcggc      1920
     atcgacgaca tggtgatccc ggagaagaaa gcggggatta tcgccgaggc cgaagccgaa      1980
     gtggccgaga tccaggagca gttccagtct ggtctggtga ccgccggcga acgttataac      2040
     aaggtcatcg atatctgggc cgccgcgaac gagcgcgtgg ccaaggcgat gatggaaaac      2100
     ctgtctagcg aaaccgttat caaccgcgat ggcgaagaag agcgtcaggt ctcctttaac      2160
     agcatcttta tgatggccga ctccggtgcg cgtggttctg ccgcccagat ccgtcagctg      2220
     gccggtatgc gtggcctgat ggcgaagccg gatggttcca tcatcgaaac accgatcacc      2280
     gcaaacttcc gtgagggtct gaacgtactg cagtacttca tctcaactca cggtgcgcgt      2340
     aaaggtctgg cggataccgc actgaagacg gcgaactccg gttacctgac ccgtcgtctg      2400
     gtcgacgtgg cccaggacct ggtggttatc gaggacgatt gtggtaccca caacggcatc      2460
     gtgatgaccc cggttatcga aggtggcgac gttaaagagc cgctgcgtga ccgcgttctg      2520
     ggtcgagtga cggcagaaga agtgctgaag ccgggtacgg cggacattct ggtgccgcgt      2580
     aacaccctgc tgaacgaaaa atggtgtgac ctgctggaag agcactctgt cgacagcgtg      2640
     aaagtacgct ccgtcgtaag ctgtgaaact gacttcggcg tgtgcgccca ctgctacggt      2700
     cgcgatctgg cccgtggtca cctggtgaac aaaggcgaag ccatcggcgt tatcgcggca      2760
     cagtccatcg gtgaaccggg tacccagctg accatgcgta ccttccacat cggtggtgcg      2820
     gcatcgcgtg cggcggcgga gtccagcatc caggtgaaga acaagggtaa cctgaagctg      2880
     agcaacgcca agttcgtggt gaactctgac ggtaagctgg ttatcacctc acgtaatacc      2940
     gagctgaagc tgatcgacga attcggtcgt accaaggaaa gctacaaagt gccttacggt      3000
     gccacgctgg ccaagggtga cagtgccgag gtgaacggcg gtgagacagt ggctaactgg      3060
     gatccgcata ccatgccggt tatcactgag gttagcggct tcatccgctt cgccgatatg      3120
     atcgacggcc agacggtaac ccgtcagacc gacgagttga ccggtctctc ctctcaggtg      3180
     gttctggatt ctgcagagcg taccggcagc ggtaaagatc tgcgtccggc gctgaagatc      3240
     gttgacgcca acggtgatga cgtgctgctg ccgggtaccg atatgccggc ccagtacttc      3300
     ctgccgggta aggcgatcgt gcagctggag gatggcattg ccatcagcgc cggtgatacc      3360
     ctggcgcgta ttccgcagga atctggcggt accaaggata tcaccggtgg tctgccgcgc      3420
     gttgccgacc tgttcgaagc ccgtcgtccg aaagagccgg caatcctggc tgagatcagc      3480
     ggtgtggttt ccttcggtaa agagaccaag ggcaagcgtc gattggtgat tacgccactg      3540
     gatggcagcg atacctacga agagatgatt ccgaagtggc gtcagctcaa cgtgtttgaa      3600
     ggtgaacgcg ttgaacgcgg cgacgtgatc tccgatggtc cggagtctcc acacgacatc      3660
     ctgcgtctgc gcggtgtgaa cgcggtaacc cgctatatcg ttaacgaagt ccaggacgta      3720
     taccgtctgc agggcgttaa aattaacgat aagcatatcg aggttatcgt gcgtcagatg      3780
     ctgcgtaagg cgaccatcgc taatgccgga agctctgagt tcctggaagg cgagcaggtg      3840
     gaagtgtccc gcgtcaagat tgccaatcgc ctgttggagt ctgatggcaa gattgctgcg      3900
     acctatatgc gcgatctgct gggtatcacc aaagcgtctc tggcgaccga gtccttcatc      3960
     tctgcggcct ccttccagga gactacccgc gtgctgactg aagcggccgt tgccggtaag      4020
     cgtgatgagc tgcgtggcct gaaagagaac gtcatcgttg gtcgtctgat cccggcgggt      4080
     accggctatg cctaccacca ggatcgcatg cgtcgtcgat ctaccgatac gtctagcgca      4140
     ccgcaggtga gcgcggaaga agccagcgct aacctggccg agctgctgaa cgcaggtctg      4200
     ctgggtggca atgacgaata a                                                4221
//

If you have problems or comments...

PBIL Back to PBIL home page