(data stored in ACNUC7421 zone)

EMBL: CP001600.PE157

CP001600.PE157       Location/Qualifiers
FT   CDS_pept        complement(178073..180004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0177"
FT                   /product="thiamine biosynthesis protein ThiC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67424"
FT                   /db_xref="GOA:C5BHE6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE6"
FT                   /protein_id="ACR67424.1"
FT                   /translation="MSTLTHSDAPRRQRRAQAQAFIDNLQAQAFPSSQRIYLQGSRADI
FT                   RVPLREITLSPTLIGGTPEQPQWRDNEAIAVYDTSGAYGDQQAEIDLRRGLPGIRCAWI
FT                   AERNDSEILPGRSSDYTRRRQADQDLETLRFELRSPARRARPGHRVTQLHYARQGIITP
FT                   EMEFIALRENMGRERIRSAILRQQHPGIAFGAHLPDNITPAFVRDEVAAGRAIIPANIN
FT                   HPESEPMIIGRNFLVKVNANIGSSSVTSSIEEEVEKLVWATRWGADTVMDLSTGRYIHE
FT                   TREWILRNSPVPIGTVPIYQALEKVNGIAENLDWPLVRDTLLEQAEQGVDYFTLHAGLL
FT                   LRFIPMTAERLTGIVSRGGAIMAKWCLSHHQENFLYTHFREICEICSAYDIALSLGDGL
FT                   RPGSIQDANDQAQFAELHTLGELTQIAWEYDVQVMIEGPGHVPMHMIQRNMEEELNHCH
FT                   EAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCALLCYVTPKEHLGLPDKDDVKQGL
FT                   ITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPVTARAYHDATLPQA
FT                   SGKLAHFCSMCGPKFCSMKISREVREHAARQQEAEPGMAQMAQQFREQGGDIYLTNIAD
FT                   NAPLHKEP"
     atgtctaccc taactcacag cgacgcgccg cgtcgccagc gccgggccca ggcccaggcc        60
     tttatcgaca atctccaggc gcaagccttt cccagctccc agcgcatcta cctgcaagga       120
     tcgcgagcgg atatccgcgt ccccctgcgt gaaattacgc tgagtccaac cttgatcggt       180
     ggaacgccag agcagccgca gtggcgtgat aatgaggcga ttgccgtgta cgacacctcc       240
     ggcgcctatg gcgatcagca ggcggagatc gatctgcgcc gcgggctgcc gggcatacgc       300
     tgcgcctgga tcgccgagcg caacgacagc gaaatcctgc cggggcgcag ctcagactat       360
     acccgccgcc gccaagccga tcaggatctg gagacgctgc gttttgaact gcgctctccc       420
     gcacggcgcg cgcggccggg acaccgggtc acacagctgc actatgccag acagggtatc       480
     atcaccccgg aaatggagtt tatcgcgctg cgcgaaaata tgggacgcga acgtattcgc       540
     agtgccattt tacgtcagca gcacccgggg atcgccttcg gtgcccacct tccggacaat       600
     atcacgccgg cgttcgtccg agacgaagtc gccgccgggc gcgccatcat tccagccaat       660
     attaaccacc ctgagtcaga gccaatgatt atcgggcgta actttctggt aaaggtcaac       720
     gcgaacatcg gcagctcatc tgtcacctcc tctatagagg aagaggtcga aaagctagtg       780
     tgggccaccc gctggggcgc cgataccgtg atggatctct ctaccggtcg ctacattcac       840
     gagacacgtg agtggatcct ccgcaacagc ccggtaccca tcggtaccgt ccccatctat       900
     caggcgctgg agaaggtcaa cggtatcgcc gagaatctcg actggccgct ggtccgggat       960
     acactgttag aacaggcgga gcaaggcgtg gactatttca ccctgcacgc gggtctgctg      1020
     ctacgcttca tcccgatgac cgccgagcgc ctgaccggca tcgtatcgcg cggcggcgct      1080
     atcatggcca agtggtgtct gtcacaccac caggagaact tcctctatac tcacttccgc      1140
     gagatctgcg agatctgtag cgcctatgac atcgcgcttt cactcggcga cggcctgcgt      1200
     cccggatcga tccaggatgc caacgatcag gcacagttcg ccgagctgca taccctcggc      1260
     gagctgaccc agatcgcctg ggaatacgat gtgcaggtga tgatcgaagg cccgggccac      1320
     gtccctatgc acatgatcca gcggaatatg gaggaagagc tcaatcactg ccacgaagcc      1380
     cccttctata ccctggggcc gttaacgacc gacatcgcgc caggctacga ccatttcacc      1440
     tctggcatcg gcgccgccat gatcggttgg tttggctgcg cgttactgtg ctatgtcacg      1500
     cccaaggagc atctggggct gcccgataag gatgacgtca agcaggggct catcacctat      1560
     aagatcgcag ctcacgccgc cgatctggcc aaggggcatc ccggcgcaca aattcgcgat      1620
     aacgccatgt ccaaggcccg cttcgaattc cgctgggagg atcagttcaa tctggcgctc      1680
     gatccggtga cggcacgcgc ttatcacgat gccaccctgc cgcaggcatc cggtaagcta      1740
     gcccacttct gctcgatgtg tgggccaaaa ttctgttcta tgaagatctc tcgcgaggta      1800
     cgcgagcatg ctgcacgcca gcaggaggcc gaacctggca tggcgcaaat ggcgcagcag      1860
     ttccgggagc agggaggtga catctatctg acgaatatcg ccgacaacgc accgctgcat      1920
     aaggagccgt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page