(data stored in ACNUC7421 zone)

EMBL: CP001600.PE163

CP001600.PE163       Location/Qualifiers
FT   CDS_pept        184187..184861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0184"
FT                   /product="Protein of unknown function (DUF1481)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67430"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF2"
FT                   /protein_id="ACR67430.2"
FT                   /translation="MTPLLSMCHRVRGLLPVALLLTGCHSAVPVAPFTATGYIADGGIV
FT                   RLWRLEGAGHQPQAMMRVFTPLDGTETQIDRYTYRAGYLYQILQQTGQGNDDVLQLRFD
FT                   MQGALSYMQRLRNGSKEMPGSDEVAKAQYQARHAQEMAATLVAGGVNLIQGRWQGGIFT
FT                   RCDGQVSPLPLSGWQAAQLARREANSRGPLWVAWLSAPEGAQLLQVANHNICAWAPTEK
FT                   TV"
     atgacgcccc ttttgtctat gtgccaccgg gtacgtgggc tgctgccggt cgcactgctg        60
     ctgaccggct gccattctgc tgtgccggtg gcgccgttta ctgcgacggg atatatcgcg       120
     gatggcggga tcgttcgact ctggcgccta gagggagcgg ggcatcagcc tcaggcgatg       180
     atgcgggtat tcaccccgct ggatggcacc gagacacaga tcgatcgcta tacctaccgc       240
     gccggatatc tgtaccagat cctgcagcag acgggacagg gtaatgatga tgtgctgcag       300
     ctgcgcttcg atatgcaggg cgcgctaagc tatatgcagc gtctgcgcaa cgggagcaag       360
     gagatgccgg ggagcgacga ggtcgccaaa gcccagtatc aggcccgcca tgcgcaggag       420
     atggcggcga cgctggtggc cggtggggta aatctcatcc aggggcgttg gcagggggga       480
     atatttactc gctgcgatgg tcaggtctcg ccgctgccgc tctccggctg gcaggcggca       540
     cagctggcgc ggcgagaggc caatagccgt ggcccgctat gggtggcctg gctgtcggct       600
     ccggagggcg cacagctact gcaggtcgcc aatcataata tctgcgcttg ggcaccgacg       660
     gaaaaaacag tgtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page