(data stored in ACNUC7421 zone)

EMBL: CP001600.PE165

CP001600.PE165       Location/Qualifiers
FT   CDS_pept        complement(186215..187804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0186"
FT                   /product="bifunctional purine biosynthesis protein,
FT                   putative"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67432"
FT                   /db_xref="GOA:C5BHF4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF4"
FT                   /protein_id="ACR67432.1"
FT                   /translation="MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLS
FT                   QAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVN
FT                   LYPFAQTVARPDCSQEDAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFENIIAEMDAH
FT                   HGALTQATRFDLAIKAFEHTAAYDSMIANYFGSLVAPYHGDIHSPSGRFPRTLNLNLVK
FT                   KQDMRYGENGHQQAAFYIEEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFTEP
FT                   ACVIVKHANPCGVALGDDLFDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIITRQFV
FT                   EVIIAPHVTEDALDLLSAKQNVRVLACDEWDVRVPGLDFKRVNGGLLVQDRDLDMVDAA
FT                   DLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLQIAGSVMASDAFFPFRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHDI
FT                   AMIFTGMRHFRH"
     atgcaacaca gtcgtcctgt tcgccgcgca ctgctgagtg tctccgataa atccggtatc        60
     gtcgaattcg cccaggcctt acatctacgc ggcgttgaac tgctctccac cggcggtacc       120
     gcccgcctcc tgtcacaggc cggcctgccg gttaccgagg tttccgacta cacgggcttt       180
     cctgagatga tggatggacg tgtcaagacc ctgcatccca aggttcacgg tgggatcctc       240
     ggacgtcgcg atcgcgacgc agccgttatg cagcagcatg gtattcagcc catcgatatg       300
     gtcgtcgtca atctctatcc ctttgctcaa accgttgcgc gtcccgactg ttcgcaggag       360
     gacgcggtgg agaatatcga tatcggcggg ccgaccatgg tgcgctccgc ggcgaagaac       420
     cataacgatg tggctatcgt ggttaacaac ggtgactttg agaacattat tgccgaaatg       480
     gatgcccacc acggagccct gacgcaggcc acccgcttcg acctagccat taaggccttt       540
     gagcatacag ccgcctacga cagtatgatc gccaactact ttggttcgct ggtcgccccc       600
     taccacggcg atatccatag tccaagcggc cgcttcccgc ggacgctaaa ccttaatcta       660
     gtaaaaaaac aggatatgcg ctacggcgaa aacggccacc agcaggccgc cttttatatt       720
     gaggagccac aggttgaagc ctgcatcgct actgcccagc agcttcaagg gaaggcgctg       780
     tcctacaata acatcgccga taccgacgcc gcgctggagt gcgtcaaaag ctttaccgag       840
     ccggcctgcg tcatcgtcaa acatgccaac ccctgcggcg ttgcgctcgg cgacgatctg       900
     ttcgatgcct atgagcgtgc ctaccagacc gatcccacct ccgcctttgg cggcatcatc       960
     gcctttaacc gcacgttgga tgccaagacc gctcaggcta tcatcacgcg ccagttcgtt      1020
     gaggtcatca tcgcgcccca tgtgactgag gatgccctgg atctcctcag cgccaagcaa      1080
     aacgtgcgcg ttctggcctg tgatgagtgg gatgtccgcg tccccggcct ggactttaaa      1140
     cgggtcaatg gggggctatt ggtgcaggat cgcgatctgg acatggtgga tgccgccgat      1200
     ctgcgcgtgg tcaccgaacg ccagcccagc gagcaggagc tgcgcgatgc cttgttctgc      1260
     tggaaagtcg ccaagtttgt taagtccaac gccatcgtct atgcacggga taacatgacc      1320
     gttggcatcg gggccggaca gatgagccgg gtctattcag ccaaaattgc cggtatcaaa      1380
     gccgcggacg agggtctaca gatcgccgga tccgtgatgg catccgatgc cttcttccca      1440
     ttccgtgacg gtatcgatgc cgccgccgcc gtcgggatcc gctgcgtcat ccagccgggg      1500
     ggctctatcc gcgatgacga ggtcattgcc gccgctaacg aacacgacat cgccatgatc      1560
     tttaccggca tgcgccactt ccgccactaa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page