(data stored in ACNUC7421 zone)

EMBL: CP001600.PE167

CP001600.PE167       Location/Qualifiers
FT   CDS_pept        complement(195309..195620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0192"
FT                   /product="Protein of unknown function, DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67435"
FT                   /db_xref="GOA:C5BHF7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF7"
FT                   /protein_id="ACR67435.1"
FT                   /translation="MNDTIYQEIEENPRFKELVRKRGRFVWLLSLITLALYVGFILLIA
FT                   FDPQWLGTPIAAGSTITRGIPVGVGLIVISFILTGIYVFRANGEFDRLTAEILSEVKQ"
     atgaatgaca ccatttatca agagattgaa gaaaacccgc gctttaaaga gctggtgaga        60
     aaacgcggcc ggttcgtctg gctgctttcg ctgattacgc tggcgctgta cgtcggcttt       120
     attctgttga tcgccttcga tccgcaatgg ctcggcacgc cgatcgccgc cggatcgacc       180
     atcacccgcg ggatcccggt tggtgtcggg ctgatcgtga tctctttcat cttgaccggg       240
     atctatgtat tccgcgccaa cggcgagttc gatcgtctca ccgcagaaat cctgagtgag       300
     gtgaaacaat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page