(data stored in ACNUC7421 zone)

EMBL: CP001600.PE170

CP001600.PE170       Location/Qualifiers
FT   CDS_pept        complement(198008..198136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67438"
FT                   /db_xref="GOA:C5B6X6"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6X6"
FT                   /protein_id="ACR67438.1"
FT                   /translation="MGAATPFFISCHFPSAIIRYNLSAVRHSLGFIIIIYAIKRDI"
     ttgggcgccg caacgccctt ttttatctct tgtcacttcc cttcggcgat catccgctac        60
     aatctgtccg ctgtacgtca ctcacttgga tttataatta ttatttatgc aataaaacgg       120
     gatatatga                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page