(data stored in ACNUC7421 zone)

EMBL: CP001600.PE172

CP001600.PE172       Location/Qualifiers
FT   CDS_pept        complement(198871..200304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0197"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67440"
FT                   /db_xref="GOA:C5B6X8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6X8"
FT                   /protein_id="ACR67440.2"
FT                   /translation="MQMKKLLPLLIGLSLSGFSALSQAENLMQVYQQAKESNPDLRQAA
FT                   ANRDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSNNYGATLALTQTIFDMSK
FT                   WRQLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQLTYTEANKQAIYNQLDQ
FT                   TTQRFKVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALRQITGQYYPQLSALNI
FT                   DRFSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETGYMPTLNLTASTGVS
FT                   NTDYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQVKQAQYNFVGASE
FT                   ALDSAHRGVVQNVRSSFNNISAAISSVSAYKQAVVSAQSSLDATQAGYQVGTRTIVDVL
FT                   NATTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLMLNGDLSKTVPTAADSIAP
FT                   DDAAQAAKANGPIPGGGVR"
     atgcaaatga agaaactgct ccctcttctt attggcctaa gcctcagtgg cttcagtgca        60
     ttaagtcagg cagaaaacct gatgcaggta tatcagcagg ccaaagaaag caacccggat       120
     ctccgtcagg ctgctgctaa ccgtgatgct gcatttgaaa agatcaatga gtcccgcagc       180
     ccgctgctgc cacagctggg gcttggcgct gactatacct ataccaacgg ctttcgcgac       240
     agcagtggcc taaactcaaa taattacggg gctaccctgg cgctgacgca gacaatcttt       300
     gatatgtcca aatggcgtca gctctcgctg accgaaaagc aggccggaat tcaggatgta       360
     tcctatcagt cctctgaaca gacgctgatg ctgaatactg ccaccgccta ctttaacgtg       420
     ctgcgtgcca tcgatcagct gacctatacc gaagccaaca aacaggcgat ttacaatcag       480
     ctcgatcaga cgacccagcg cttcaaggtc ggcttggtgg ccattaccga cgtacagaac       540
     gcccgagcgc agtacgatca ggtgctggcc caagaggtca gcgcacgcaa caatctggat       600
     aactcgctgg aagccctacg ccagatcacc ggccagtact atccacagct ctccgccctg       660
     aatatcgatc gcttcagcac caagcgccct gacgatgtga aagcgctgct gcaagaggcc       720
     gagaaacgca acctgcagct gttaagcgcc cgcctgagcc aggacttggc acgtcagcag       780
     atcaagtatg cagaaaccgg ctatatgccg accctgaatc tgacagcctc caccggcgtc       840
     agcaataccg actataactc cctctccaac gcgcagaaag aaacgctgcg gggaggcaat       900
     ggtagcagct atcagggaca gaacactgtg ggcctgagct ttaacctgcc gctatactcc       960
     ggcggtgcca ccaactcgca ggtgaaacag gcgcagtaca actttgtcgg cgccagcgag      1020
     gccctggaca gcgcccaccg cggcgtggtg cagaatgtcc gctcctcctt caacaacatc      1080
     tctgccgcca tcagcagcgt atctgcctat aaacaggccg tagtctcagc ccaaagctcc      1140
     ctggatgcca cccaggccgg ttatcaggtg ggcacccgta ccatcgtcga tgtattgaat      1200
     gccaccacgg cgctgtacaa cgccaagcag aacctggcca acgcgcgcta tgactacctg      1260
     atcagccagc tgaacatcaa gtatgcgctg ggtaccctca atcaaaacga tctgctgatg      1320
     ctcaacggcg atctgagcaa aacggtcccg acagcggccg acagcattgc tcctgatgat      1380
     gcggcccagg ccgccaaagc caatgggccg atccccggtg gcggcgtacg ctaa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page