(data stored in ACNUC7421 zone)

EMBL: CP001600.PE175

CP001600.PE175       Location/Qualifiers
FT   CDS_pept        201541..202368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0200"
FT                   /product="Calcineurin-like phosphoesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67443"
FT                   /db_xref="GOA:C5B6Y1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y1"
FT                   /protein_id="ACR67443.1"
FT                   /translation="MESLFHLAVASGAPVRLLQITDTHLFAGQQETLLGVNTYRSYQAV
FT                   LAAIRAEAHPFDLIVATGDLAQDHSAAAYRHFAAGVAELHRPCLWLPGNHDFQPAMVDA
FT                   LAQAGVHANKRALLGECWQIVLLDSQVVGVPHGELSDYQLEWLELTLASEPQRHTMLLL
FT                   HHHPQPSGCTWLDQHSLRNAHALDEILRRYPQVNTLVCGHIHQELDLDWNGRRLLATPS
FT                   TCVQFKPLCTNFTIDTISPGWRYLTLYPDGRVTTAVHRLASSEFRPDLDADGY"
     ttggaaagcc tgtttcatct ggccgtagcg agtggggcgc cggtcagatt attgcaaatt        60
     actgataccc acctatttgc agggcaacaa gagaccctgc tgggggtcaa tacctaccgc       120
     agctatcagg ctgtattggc ggcgatccgc gctgaggcgc atccgttcga tcttatcgtc       180
     gcgacgggag acctcgcgca ggatcactcc gcagccgcct atcggcattt tgccgcgggt       240
     gttgccgagc tgcacaggcc ctgcctgtgg ctaccgggga atcatgattt tcagccagcg       300
     atggtcgacg cgctggcgca ggccggtgta catgcaaaca agcgggctct gctgggggag       360
     tgctggcaga tcgtcttgct ggacagccag gtcgttggcg ttccacacgg tgagctgagc       420
     gattatcagc tcgagtggct ggagctgacg ctggctagcg aaccgcagcg ccacacgatg       480
     cttctgctgc atcatcaccc acagccctca ggctgtacct ggctggatca gcacagtctg       540
     cgcaatgcgc acgcgttgga tgagatcctg cggcgctatc cccaggtcaa tacgctggtg       600
     tgcggtcata ttcatcagga actggatctg gactggaacg ggcgccgact gctggcgacg       660
     ccgtcgacct gcgttcagtt taaaccgctg tgcaccaatt ttaccattga taccatttct       720
     ccgggctggc gctatctgac cctgtatcct gacgggcgcg tgaccacggc ggtgcatcgc       780
     ctggccagca gtgagttcag gccggatttg gacgcagacg gctattga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page