(data stored in ACNUC7421 zone)

EMBL: CP001600.PE176

CP001600.PE176       Location/Qualifiers
FT   CDS_pept        202371..202952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0201"
FT                   /product="Uncharacterized protein family (UPF0227)"
FT                   /note="Uncharacterised protein family (UPF0227)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67444"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y2"
FT                   /protein_id="ACR67444.1"
FT                   /translation="MPTLLYLHGFNSSPRSAKAMALQCWLAEHHPQITMLIPQLPPYPA
FT                   DAAQMLEELVMERAGRPLGLVGSSLGGYYATWLSQCFTLPAVVINPAVKPFELLLDFLG
FT                   QNENPYTGQQYVLESRHVFDLKVMQVDPLESPDLIWLLQQTGDEVLDYRQAVTYYTPCR
FT                   QTIEEGGNHAFAGIERFFPQIIDFLGLSAE"
     atgcctactc ttctctatct tcacggtttt aacagttctc cccgctctgc caaagcgatg        60
     gcgctgcagt gctggctggc cgagcaccac ccgcaaataa ccatgctgat cccgcagctg       120
     ccgccatacc ccgccgatgc ggcgcagatg ctggaggagc tggtgatgga gcgcgcgggg       180
     cgccccttgg gtctggtggg ctcctctctt gggggatatt atgccacctg gctttcccag       240
     tgttttaccc tgccggcggt ggtgattaac ccggcggtaa agcctttcga gctgctgctg       300
     gactttttgg ggcagaatga gaacccctac accgggcagc aatatgtgct agagtcacgc       360
     cacgtctttg atttgaaggt gatgcaggtg gaccctctgg agtcaccgga tctgatctgg       420
     ttgctgcagc agaccggcga cgaagtactg gattaccgcc aggccgtgac ctactacacc       480
     ccatgccgcc agactattga agagggcggt aatcacgctt tcgccgggat tgagcgcttt       540
     ttcccgcaaa tcatagactt tttggggctg agcgcggagt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page