(data stored in ACNUC7421 zone)

EMBL: CP001600.PE177

CP001600.PE177       Location/Qualifiers
FT   CDS_pept        203059..204954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0202"
FT                   /product="DNA topoisomerase IV, B subunit, putative"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67445"
FT                   /db_xref="GOA:C5B6Y3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y3"
FT                   /protein_id="ACR67445.1"
FT                   /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHATRIEVILHPDQSLEVIDNGRGMPVDIHPEEGVPAIELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSRRVEVSVRRDGQIYQMAFENGEKVEDLHVSGTVGRRNTG
FT                   TSVHFWPDAQFFDSARFSVSRLTHLLKAKAVLCPGVEILFRDLVNGSEQRWCYQDGLTD
FT                   YLMESVNGLVTLPEQPFTGTFASDTEAVDWALLWLPEGGELLTESYVNLIPTPQGGTHV
FT                   NGLRQGLLDAMREFCEFRNLLPRGVKLTADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQSAELLAELAINSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKVCILADADSDGLHIATLLCALFVRHFRPLVQA
FT                   GHVYVAMPPLYRIDLGKEVFYALSEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLAIEDEDMERTVAVMDMLLAKKRAEDRRNWLQENGNLAELDV"
     atgacgcaat ccagctataa tgctgacgcc attgaggtgc tcagcggtct tgaacccgtg        60
     cgccgccgcc cggggatgta taccgatacc acccgtccca accatttggg gcaggaagtg       120
     atcgataaca gtgttgatga ggcgctggcc ggtcacgcga cgcgtattga ggtgatcctg       180
     caccccgatc agtcgctgga ggtgatcgat aacgggcgtg gaatgccggt cgatatccat       240
     cctgaagagg gcgtcccggc cattgagctg atcctttgcc gcctgcacgc cgggggtaaa       300
     ttttccaaca agaactacca gttttccggc ggtctgcacg gcgtggggat ttcggtggtc       360
     aacgccctgt cacgccgggt tgaggtcagc gtccgccgcg atggccagat ctatcagatg       420
     gcgtttgaaa acggtgaaaa ggtggaggat ctgcacgtca gcggaacggt gggacggcgt       480
     aacaccggca ccagcgtaca cttctggccc gatgcgcagt tctttgactc cgcccgtttc       540
     tcggtttcgc gtctgaccca tttactgaag gcgaaagcgg tgttgtgccc cggtgtggag       600
     attctgttcc gcgatctggt caacggcagc gaacagcgct ggtgctatca ggatggcctg       660
     accgactacc tgatggagtc ggtcaatggg ctggtgacgc tgccggagca gccgtttacc       720
     ggtaccttcg cctccgatac cgaggcggtc gactgggcgc tgctgtggct gcccgagggc       780
     ggggagctgc tgacggagag ctacgttaac ctgataccga ctccacaggg cggcacccac       840
     gtgaacggcc tgcgtcaggg gctgctggat gcgatgcgtg aattctgcga gttccgtaac       900
     ctgctgccgc gcggcgtcaa gctgactgct gacgacatct gggagcgctg cgcctatgtg       960
     ctgtcggtta agatgcagga tccgcagttt gccgggcaga ccaaagagcg tctctcctca      1020
     cgtcagtgcg ccgcctttgt ctccggggtg gtcaaagatg cctttagtct gtggctgaac      1080
     caaaacgtgc agtcggccga actgctggct gagctggcga tcaacagcgc ccagcgccgc      1140
     atgcgtgcgg caaagaaggt ggtgcgtaag aagctgacca gtggaccggc attgccgggt      1200
     aagctggcgg actgcagcgc tcaggatctg aaccgcaccg agctgttcct ggtggaaggg      1260
     gattcggcgg gcggttcggc caagcaggcg cgcgatcgtg aataccaggc gatcatgccg      1320
     ctgaagggga agatcctgaa tacttgggag gtctcctccg atgaggtgct ggcgtcgcag      1380
     gaggtgcacg atatttcggt cgctatcggt atcgatccgg acagcgatga cctcagccag      1440
     ctgcgctatg gcaaagtctg tatcctggcc gatgcggact cggacggact gcatatcgcc      1500
     accctgctgt gtgcgctgtt cgttcgccac ttccgcccgc tggtgcaggc gggccacgtc      1560
     tatgtcgcga tgccgccgct gtaccgtatc gatctcggca aagaagtgtt ctatgccctg      1620
     agcgaagagg agaaggccgg ggtgctggag cagctgaaac gcaagaaagg caagcccaac      1680
     gtgcagcgct ttaaagggct gggcgagatg aacccgctgc agctgcgtga aaccacgctg      1740
     gatcccaata cccgccgtct ggtacagctg gccattgagg atgaggatat ggagcgtacc      1800
     gttgccgtca tggatatgct gctggccaaa aaacgcgccg aagatcgccg caactggctg      1860
     caggaaaacg gcaatctggc tgagctggac gtgtga                                1896
//

If you have problems or comments...

PBIL Back to PBIL home page