(data stored in ACNUC7421 zone)

EMBL: CP001600.PE178

CP001600.PE178       Location/Qualifiers
FT   CDS_pept        205140..207422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0203"
FT                   /product="DNA topoisomerase IV, A subunit, putative"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67446"
FT                   /db_xref="GOA:C5B6Y4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y4"
FT                   /protein_id="ACR67446.1"
FT                   /translation="MSDLTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTE
FT                   AEIITPRDEIHKIYRTGRGSVRMRAVWRKEEGEIVISALPHQTSGAKVLEQIASQMRAK
FT                   KLPMVDDLRDESDHENPTRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDR
FT                   RPAVKDLREILSEWLSYRRETVRRRLNYRLEKVLKRLHILDGLLCAFLNIDEVIHIIRS
FT                   EDEPKPVLVARFGLSDTQAEAILELKLRHLARLEEVKIRGEQDELAQERDRLQTLLASE
FT                   RKLGTLIKKEIMADAETYGDARRSPLQERSEARAMSEHDFVPNEPVTIVLSEGGWVRSA
FT                   KGHDIDPSGLNYKAGDAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAADDQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENANVL
FT                   TPLEINGDDDMLLAITEAGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLL
FT                   VLAPQTSLTLHIGKRKLVMKPQDLQKFRAERGRKGTLLPRGLQRIERVDVDAPLSLRLD
FT                   ADAEGDA"
     atgagcgatc tgactcatga caacagtgag cgtgtagcgc tccatgcgtt tactgaagac        60
     gcctatctgc aatactccat gtacgtcatc atggatcgcg cgttgccctt tatcggcgac       120
     gggctgaagc cggttcagcg ccgcatcgtg tatgcgatgt ctgagctggg gctttccgcc       180
     agcgcaaaat ttaaaaagtc ggcgcgcacc gtcggtgatg tgctgggcaa gtatcacccc       240
     cacggcgaca gcgcctgcta tgaggcgatg gtgctgatgg cgcagccctt ctcctatcgc       300
     tatccactgg tggatggaca gggaaactgg ggggcgccgg acgatccgaa atcgttcgcg       360
     gcgatgcgtt ataccgaatc acgtctgtcg cgctacgcgg agattttact cagcgagctg       420
     ggacagggca cggtggacta tgtcgccaac ttcgacggca cgctgcagga gcctaaattc       480
     ctgccggcgc ggctgcctaa tatcctgctg aacggcacga ccggtatcgc ggtcggcatg       540
     gcgacggata ttccgccgca caacgcgcgc gaggtcgcgg cggcgttggt ggccctgctg       600
     gacaatccgc agagctcgct ggacgatctg ctgacgcaca ttcaggggcc ggatttcccg       660
     accgaggcag agatcatcac gccacgtgac gagatccaca agatctatcg caccggtcga       720
     ggatcggtac gcatgcgggc ggtatggcgc aaggaagagg gcgagatcgt gatcagcgcc       780
     ctgccgcacc agacctccgg cgccaaggta ctggagcaga tagccagcca gatgcgggct       840
     aagaagctac cgatggtcga cgatttgcgc gatgagtcgg atcatgagaa tccgacacgt       900
     ctggtgatcg taccgcgttc taaccgggtc gatctcgatc agctgatgaa tcatctgttt       960
     gccaccaccg atctggaaaa aagctaccgc atcaacatga acatgatcgg tctggatcgg      1020
     cgtccggcgg tgaaagatct gcgtgagatc ctcagcgagt ggctgagcta ccgccgtgag      1080
     acggtgcgtc gccgcctgaa ctaccgtctg gagaaggtgc tgaagcgcct gcatattctg      1140
     gatggcctgc tgtgcgcgtt tttgaatatc gacgaggtga tccatatcat ccgcagcgag      1200
     gatgagccca agccggtgct ggtggcgcgc tttggcctca gcgatactca ggctgaggcg      1260
     attctggagc tcaaactgcg tcatctggcc cgcctggaag aggtgaagat ccggggcgaa      1320
     caggacgagc tggcgcagga gcgggatcgc ctgcagacgc tgctggcctc cgagcgtaag      1380
     ctgggtacgc tgatcaagaa agagatcatg gcggatgccg aaacgtacgg cgacgcacgg      1440
     cgctcaccgc tgcaagagcg ttctgaagcg cgggcgatga gcgaacacga ctttgtcccg      1500
     aacgaaccgg tgaccatcgt cctgtctgaa ggggggtggg tacgcagcgc caaggggcat      1560
     gacattgatc cgagcggact gaactataag gcgggcgatg ctttccgcgc cgctgcgcgc      1620
     ggcaagagca accagccggt ggtctttatc gactccagcg gacgcagcta tgccctcgat      1680
     ccgctgaccc tgccgtcggc gcgtgggcag ggtgagcctt tgaccggtaa actgacgccg      1740
     ccgccggggg caaccatcga acacgtactg atggctgcgg atgatcagaa gctgctgatg      1800
     gcctctgacg caggctatgg ttttgtctgt acctttagcg atctggtcgc gcgtaaccgc      1860
     gcaggcaagg ccatgttgac gctgccggaa aatgccaatg tgctgactcc gctggagatt      1920
     aacggtgacg atgacatgct gctggccata accgaggctg gacggatgct gatgttcccg      1980
     gtacacgatc tgccgcagct ctccaagggc aaggggaata agatcgtctc catccccgca      2040
     gcacaggccg ccgccggtga ggatacgctg aaatggttgc tggtactggc gccgcagaca      2100
     tcgctgacgc tgcatatcgg taagcgtaaa ctggtgatga aaccacagga tttgcagaaa      2160
     ttccgtgccg aacgcgggcg caagggaacc ctgctaccgc ggggactgca gcgcattgag      2220
     cgggtagatg tggatgcccc gctgtcgctg cgtctggacg ctgatgccga gggcgacgcg      2280
     taa                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page