(data stored in ACNUC7421 zone)

EMBL: CP001600.PE18

CP001600.PE18        Location/Qualifiers
FT   CDS_pept        16934..17458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0020"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67280"
FT                   /db_xref="GOA:C5B9A0"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A0"
FT                   /protein_id="ACR67280.1"
FT                   /translation="MSSVALAEIGDKTQLLTLLLVARFGKPVLILLAIILATLVNHYFA
FT                   ALIGELVTQFLSPQIMRWMVAAGFLVMAVWVLFPDKNDGEIRGGHPFWTSLAVFFLAEI
FT                   GDKTQIATVLLGAHYQHITWVVLGSTLGMVLANAPMLWFGARLQPYLKSGWGRRLSSLL
FT                   FFILGVVTLIL"
     atgagttccg tcgccctggc tgaaattggt gataaaactc agcttttgac gctgctgttg        60
     gtagcgcgct ttggtaagcc tgtcctgatc ctgttggcaa ttattctggc aacgctggtt       120
     aaccactact ttgccgccct gataggggag ctggtcactc agtttctcag cccgcagatt       180
     atgcgctgga tggtcgcggc gggcttcctg gtcatggccg tgtgggtgtt gtttcccgat       240
     aaaaatgacg gtgagatccg cgggggacat cccttctgga cgtcgctggc ggtgttcttt       300
     ctggctgaaa ttggcgataa gacccagatt gcgaccgtcc tgctgggcgc gcactatcag       360
     catattacct gggtcgtcct ggggtcgacg ctggggatgg tgctggccaa tgcgcccatg       420
     ctgtggttcg gtgcccggct gcagccctac ctgaaaagtg gctggggaag acgactttct       480
     tccctgctgt tttttatttt aggagttgtt acccttattc tctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page