(data stored in ACNUC7421 zone)

EMBL: CP001600.PE180

CP001600.PE180       Location/Qualifiers
FT   CDS_pept        208305..209723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0205"
FT                   /product="SufI protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67448"
FT                   /db_xref="GOA:C5B6Y6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y6"
FT                   /protein_id="ACR67448.1"
FT                   /translation="MSLSRRRFIQASGLALCAGGLPLQARASGTQAVLPVPPLLESRRG
FT                   QPLFLSLERTHWAFMGGRKVGTWGVNGVYLGPTVRVHSGDDVKLIYSNRLSESVAMEVA
FT                   GLLVPGPLVGGPARQMSPGIDWSPVLPVRQAAATLWYHADTPRHMAPQVYSGLAGLWLV
FT                   EDQYSKNTPLPNHYGVDDFPLILQDKRLDNFGVPEYDPPASGGFLGDTLLVNGVQDPYV
FT                   EVSRGWVRLRLLNASNARRYLLQLSDRRPFFVIASDQGLLPAPLQVDTLPLAPGERREV
FT                   LIDMSKGEEVSITAGEAAGIMDRLRGLFEPSSMLVSTRVLTLRPTGLLPLMTDSLPARL
FT                   AADPLPEGDIVNNRSIMLGSASSPGINGMLWEPGRIDVQARQGTWERWTVRADTPQSFY
FT                   IQGAQFLVKSVNHAPPLVEDRGWKDSVWVDGEVSLLVYFPQPSYEHFPFLFYSGTLELA
FT                   DRGSVGQMVVQPAQ"
     atgtcactca gtcgacgtcg gtttattcag gcctccgggc tggcgctgtg cgccggtggg        60
     ctgccgctac aggctcgggc gagtgggaca caggccgtgc tgccagtgcc gccgttgttg       120
     gagtcacgcc gcggtcagcc gctgtttctg tcgctggagc gtacgcattg ggccttcatg       180
     ggggggcgca aagtggggac ctggggcgtg aacggtgttt atctgggacc gacagtcagg       240
     gtgcacagcg gtgacgatgt gaagctgatt tacagtaacc ggttgagcga atccgtggcg       300
     atggaggtcg ccggcctgct ggtgcccggt cctctggtcg ggggaccggc gcgccagatg       360
     tcgcccggga tcgactggtc tccagttctg cctgttcgcc aggcggcggc gacgctgtgg       420
     tatcacgcgg atactccgcg gcatatggcg ccccaggtct atagtggtct ggccggcctc       480
     tggctggttg aggatcagta cagcaagaat acaccgctgc cgaatcacta tggggtggat       540
     gattttccgc tgatcctgca ggataagcgt ctggataact ttggtgtacc cgaatacgat       600
     ccccccgcct ccggcggctt cctgggcgat accctgctgg tcaatggcgt gcaggaccct       660
     tatgttgagg tatcgcgcgg atgggtacgt ttgcgtctgc tcaacgcctc caacgcgcgg       720
     cgctacttgc tgcagctctc cgataggcgt cccttcttcg tgatcgccag cgatcagggg       780
     ctgttgcctg caccgctgca ggtcgatact ctgccgctgg caccgggcga gcgccgtgaa       840
     gtactgatcg acatgagcaa gggcgaagag gtctctatca cggctggtga ggccgccggt       900
     atcatggatc gtttgcgtgg gctgtttgaa ccgtcgtcga tgctggtgtc tacccgggtg       960
     ttgaccctgc gtcctaccgg gttgctgccg ctgatgaccg attccctgcc ggcgcgtctg      1020
     gccgccgatc cactgccgga gggcgacatc gtcaataacc gtagcatcat gctgggcagc      1080
     gcctccagtc cggggattaa cgggatgctg tgggagccag ggcgtatcga tgtccaggcg      1140
     cgtcaaggca cctgggagcg ctggacggtg cgtgcggata cgccgcagtc tttctatata      1200
     caaggggccc agttcctggt gaaaagcgtc aaccatgcgc cgccactggt agaggatcgc      1260
     ggctggaaag acagcgtctg ggttgacggc gaagtctcgc tgctggtcta tttcccgcag      1320
     ccctcatacg aacactttcc gtttctgttc tacagtggaa ccctggagct ggccgatcgc      1380
     ggcagcgttg gccagatggt ggttcagccg gcccaatag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page