(data stored in ACNUC7421 zone)

EMBL: CP001600.PE183

CP001600.PE183       Location/Qualifiers
FT   CDS_pept        215358..215558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67452"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z0"
FT                   /protein_id="ACR67452.1"
FT                   /translation="MFLEITAYAGCVNGIGMSDFQFDLRSITVTDYCFYHIEIYEIKLI
FT                   SWSLVRASLRRIDIVFANLAA"
     gtgtttttag aaataacggc ttatgccggg tgtgtcaatg gcattgggat gagtgatttt        60
     caatttgacc tgcgcagtat taccgttact gattattgtt tttatcacat tgaaatatat       120
     gaaataaaac taatctcttg gtcattagtc cgcgcgagtc tgcggcgtat agacatcgta       180
     tttgctaatc ttgccgcctg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page