(data stored in ACNUC7421 zone)

EMBL: CP001600.PE185

CP001600.PE185       Location/Qualifiers
FT   CDS_pept        complement(217612..218859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0211"
FT                   /product="Dicarboxylate/amino acid:cation (Na+ or H+)
FT                   symporter (DAACS) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67454"
FT                   /db_xref="GOA:C5B6Z2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z2"
FT                   /protein_id="ACR67454.1"
FT                   /translation="MHILRHYTFTLCLLLGIILGGLAGVLFGERATLVQPIGELFLNLM
FT                   FVVIVPLVFLSIASSIADMRQMSRLGKIMGTVFSVFIATALFAALIGFVATHLFNPFHN
FT                   VDTRSLIAHLPPTPQGQGKGVGEVIVSTFTVPDFLQLFTKSNLLPLIVFSILFGLATAF
FT                   SGEQGRPVAQFLRAGTAVILRMVKIIMYAAPLGLGCYFAATVGTLGPQIIHGYLNAFLL
FT                   YVVLTVIYFFGANTLYAFIAGGRPAVRIFWGNVFTPAITAIATASSAACIPVNLVASKK
FT                   MGVPADIAETVIPLGANTHKDGSVIGGIIKIVFLFTLFGRDMSDPMSIAAIISVAFLVG
FT                   AVMGAIPSGGMTGELMICAVFGFSPELVGTIMIISTIIDIPATLLNSTGNTVCAMLVTR
FT                   FVEGKAWLQRRWETAE"
     atgcatatac tccgacacta tacgtttacc ctctgcctgc tgctgggcat tatcctcggc        60
     gggctggccg gcgtcctgtt tggcgaacgg gctaccctgg ttcaacccat cggcgaactg       120
     ttcctgaacc tgatgttcgt ggtgatcgtt ccactggtgt tcctcagcat cgcctcctct       180
     atcgccgata tgcggcagat gtcgcgcctg ggcaaaataa tgggaacggt cttctcggtc       240
     tttatcgcca ccgccctgtt cgccgcgctg atcggctttg tcgccactca cctgtttaac       300
     ccgttccaca acgtggacac ccggtcgctg atagcccacc tgcctccgac gccgcaggga       360
     cagggcaagg gagtgggcga ggtgatcgtt tccaccttca ccgtgcccga ttttctgcag       420
     ctgtttacca agtccaatct gctgccgctg atcgtattct ccatcctgtt cggtctggct       480
     acggccttca gcggtgagca gggccgcccc gtcgcccagt tcctccgcgc cggcaccgcg       540
     gtgatcctga gaatggtcaa gatcattatg tacgcggcgc cgctgggact gggctgttac       600
     tttgccgcca cggtcggtac gctggggccg caaatcatcc acggctatct gaacgccttc       660
     ctgctgtacg tggtgctgac ggtgatctac ttcttcggcg ccaatacact gtacgccttt       720
     atcgccggag ggcgtcccgc cgtccgcatc ttctggggca atgtctttac cccggccatc       780
     accgccatcg ccaccgcctc cagcgccgcc tgcattccgg tcaacctggt ggccagcaag       840
     aagatgggcg taccggcgga tatcgccgag acggtaatcc cgctgggtgc caacacccat       900
     aaggatggct cagttatcgg cggcatcatc aagatcgtct ttctgttcac gctgttcggc       960
     cgcgacatga gcgatccgat gagcatcgct gccatcatca gcgtggcgtt tctggtcggc      1020
     gccgtcatgg gagccattcc cagcggcggc atgaccggcg aactgatgat ctgcgctgtg      1080
     ttcggctttt caccggagct ggtcggtacc atcatgatca tcagtaccat catcgatatt      1140
     ccggccaccc tactgaactc caccggcaat acggtctgcg ccatgctggt cacccgcttt      1200
     gttgagggta aggcgtggct acagcgccga tgggaaacgg cggagtaa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page