(data stored in ACNUC7421 zone)

EMBL: CP001600.PE189

CP001600.PE189       Location/Qualifiers
FT   CDS_pept        complement(220494..222065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0215"
FT                   /product="maltose transport system permease protein MalF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67458"
FT                   /db_xref="GOA:C5B6Z6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z6"
FT                   /protein_id="ACR67458.1"
FT                   /translation="MSLSQTEYPASEPRQLYPRTGLKWLAVSLLTLLTGYLTIVMYAQG
FT                   EYLFAMLTLILLGGGLYIFANRRAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSST
FT                   NQLSQERAQSVLLQRLFTSGQTYTFSLYPDGGQWRLQLTDAQSGQRYLSGPFNLSQPDL
FT                   QISMAVADSASQGSAATLRTVTQHRQTLNSLVALLPDGTALRMSSLRQFAASRPLYTLG
FT                   DDGRTLTDNQSGIAYRPNMQSGFYQAVNADGNWRSERLSPGFTVTTGWKNFLRVLNDEG
FT                   IRQPFISIFIWTLLFSVLTVIFTVAVGMVLACVVQWEALRGRAAYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMMLSQLFGIRPAWFSDPLTAKCMILIVNTWLGYPYMMILCMG
FT                   LLKAIPEDLYEASAMDGAGPLQNFFRITLPMLIKPLTPLMIASFAFNFNNFVLIQLLTN
FT                   GGPDMLGTSTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKA
FT                   SKMNFD"
     atgtcactat cccaaactga atatccggcc agcgagccgc gccaactcta cccgcgtacc        60
     gggctaaaat ggctggcggt cagcctgctc acattgctga ccggctatct gactatcgtc       120
     atgtatgccc aaggtgaata cctgttcgcc atgctaaccc ttatcctgct ggggggcggg       180
     ctatatatct tcgccaaccg gcgcgcctac gcctggcgct atgtctatcc ggggctggcc       240
     ggcatggggc tgttcgtcct gttcccgctg atctgcacca tcgccatcgc ctttaccaac       300
     tacagcagta ccaaccagct cagccaggag cgcgcccagt cggtcctgct gcagcgcctg       360
     ttcaccagcg gccagaccta cacgttcagc ctgtatccgg acggtggaca gtggcgcctg       420
     cagctcactg atgcccagag cggtcaacgc tacctttccg gcccttttaa cctgagccag       480
     cccgatctac agatttcgat ggcagtggca gacagcgcgt cgcagggcag cgccgccacg       540
     ctgcgtaccg taacccaaca ccgtcagacg ctgaacagcc tggtcgccct gctgcctgac       600
     ggcaccgcgc tgcgcatgag ctcgctgcgt cagttcgccg ccagccgccc actctacacg       660
     ctgggcgacg atggccgtac cctgacggac aaccaaagtg gcatcgccta ccgccccaat       720
     atgcaaagcg gtttttatca ggcggtcaac gccgacggca actggcgcag cgagcgcctg       780
     agcccggggt ttaccgtgac caccggctgg aaaaactttc tgcgggtact caacgatgag       840
     gggatccgcc agccctttat cagcattttt atctggaccc tgctcttctc ggtgctgacc       900
     gtcatcttta ccgtggccgt cgggatggtg ctggcctgcg tggtacagtg ggaggcgctg       960
     cgcggacgcg ccgcttatcg ggtactgctg atcttgccct atgcggtacc ggcgtttatc      1020
     tccatcctga tcttcaaggg gctgttcaac cagagcttcg gcgaaatcaa catgatgctc      1080
     agccagctgt ttggcatccg accggcctgg ttcagcgatc cgctcaccgc caagtgcatg      1140
     atcctgatcg tcaacacctg gctcggctac ccctatatga tgatcctgtg catggggcta      1200
     ctgaaggcga tccccgagga tctgtatgag gcatcggcca tggacggcgc cgggccgctg      1260
     caaaacttct tccggattac gctgccgatg ctgatcaagc cgctgacgcc gctgatgatc      1320
     gccagcttcg ccttcaactt taataacttt gtactgattc agctgttaac caacgggggg      1380
     ccggatatgc tgggaacctc gacgccggct ggctataccg atctgctggt cagctatacc      1440
     taccgtatcg ccttcgaagg cggcggcgga caagactttg gcctggctgc cgccatcgca      1500
     accctgatct tcctgctggt cggggcgctg gcgatcctca atctgaaagc cagcaaaatg      1560
     aattttgact aa                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page