(data stored in ACNUC7421 zone)

EMBL: CP001600.PE190

CP001600.PE190       Location/Qualifiers
FT   CDS_pept        complement(222203..223396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0216"
FT                   /product="maltose-binding periplasmic protein precursor,
FT                   MalE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67459"
FT                   /db_xref="GOA:C5B6Z7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z7"
FT                   /protein_id="ACR67459.1"
FT                   /translation="MTKTSTIKTIALSALAALVIAAPALAKIEEGKLVIWINGDKGYNG
FT                   LADVGKKFEQETGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   VHPSKAFQEKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPTPPRSWEEIPALDS
FT                   KLRAQGKSAIMWNLQEPYFTWPLIAADGGYAFKYVNGRYETNNVGVDNAGSRAGLQFLV
FT                   DMVKNKHINADTDYSIAEAAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGQPS
FT                   KPFVGVLSAGINAASPNKELATEFIENYLLTDSGLAMVNRDKPLGAVALKSYQEILEKD
FT                   PRIAATMQNSQNGEIMPNIPQMSAFWYAERAAIINAINGRQSVTQALESAKERILKK"
     atgacaaaga catccactat aaaaaccatc gctctcagcg cactggccgc actggtcatc        60
     gctgcaccgg cgctggccaa gatcgaagag ggtaagctgg tcatctggat caacggtgac       120
     aaggggtata acggtctggc ggacgtgggc aagaagttcg aacaggagac cggcatcaag       180
     gtgaccgtag agcacccgga caagctggag gaaaaattcc cccaggttgc ggccaccggt       240
     gacggcccag atatcatctt ctgggcccat gaccgctttg gcggctatgc ccagtccggc       300
     ctgctggccg aagtccatcc gtccaaagcg tttcaggaga agctctaccc ctttacctgg       360
     gacgccgtgc gctacaacgg caagctgatc gcctacccca tcgccgtcga ggctctgtcg       420
     ctgatttata acaaagatct gctgcccacc ccgcccagga gctgggaaga gatcccggcg       480
     ctggacagca agctgcgcgc ccagggcaag agcgccatta tgtggaacct gcaagagccc       540
     tactttacct ggccgctgat cgccgccgac ggtggctacg ccttcaagta tgtcaacggc       600
     cgctacgaga ccaataatgt cggcgtcgac aacgccggat cgcgcgccgg cctgcagttc       660
     ctggtcgata tggtgaaaaa taagcatatc aacgccgata ccgactattc catcgccgag       720
     gcggccttta acaaaggaca gaccgccatg accatcaacg gcccctgggc ctggtccaat       780
     atcgataaga gcggcattaa ctacggtatc accctgttgc caactttcaa gggacagccc       840
     tctaagcctt tcgtcggcgt actgagcgcc ggcatcaacg cggccagccc gaataaagag       900
     ctagcgaccg agttcattga gaactacctg ctgacagaca gcggcctggc aatggtcaac       960
     cgggacaagc cgctgggcgc tgtggcgctg aagtcatatc aggagatcct ggagaaagat      1020
     ccgcgcatcg ccgccaccat gcagaactca cagaacggtg aaatcatgcc gaacatcccg      1080
     cagatgagcg ccttctggta cgccgagcgc gccgcgatca tcaacgcgat caacggccgt      1140
     cagagcgtga ctcaggcact ggaaagcgcc aaggagcgga tcctcaaaaa ataa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page