(data stored in ACNUC7421 zone)

EMBL: CP001600.PE191

CP001600.PE191       Location/Qualifiers
FT   CDS_pept        223478..223633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67460"
FT                   /db_xref="GOA:C5B6Z8"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z8"
FT                   /protein_id="ACR67460.1"
FT                   /translation="MGLSPCSGHSPGAEAPMLCHSPRDPPDSHPPPLYALWGFLVICLT
FT                   QLGNMW"
     atggggctat cgccgtgttc cggtcattcg ccgggggcag aagcgccgat gttgtgccat        60
     agtccgcgag acccgcccga ttctcatcct cccccgctct acgccctgtg gggctttctt       120
     gtgatctgct taacacaact tggcaatatg tggtga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page