(data stored in ACNUC7421 zone)

EMBL: CP001600.PE195

CP001600.PE195       Location/Qualifiers
FT   CDS_pept        226437..227333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0221"
FT                   /product="maltose transport periplasmic protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67464"
FT                   /db_xref="GOA:C5B702"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:C5B702"
FT                   /protein_id="ACR67464.1"
FT                   /translation="MKIALNRLSRGVLLACALCCTPQAFADTLLPTDVAAAPELSHAAL
FT                   QALHWQPLTPPVDTTFTLGAESQTLAQGDIQGAVAALTLPANRGSLEITLSSRLHNKRL
FT                   YVPNVLVLDQHLRPAAYYPGSYFTYRQPGVMSGDRLEGTLKLTPVLGQQQIYLLIYTTR
FT                   QDLATTTRMVNPAKAYAAGVGNAVPDIPDPQAMHAPQGVLNIQARVERQSGNVMIGGLL
FT                   PTGDTPVDVAVGSPASTVAAPAAPMLDDTAAYFDRSIRSAVRQGDIDKALRLMNEAQRL
FT                   GSTTARETFIRSVKGKG"
     atgaaaatcg ccttaaaccg tctctcccgc ggcgtattgc tggcctgtgc gctctgttgc        60
     acgccacagg cgttcgccga taccttgctc ccgacggatg tggccgcggc gccggagttg       120
     agccatgcgg ctctgcaggc actacactgg cagccgctga cgccgccggt ggacaccacc       180
     ttcaccctgg gtgctgaaag tcagacgctg gcacaggggg atatccaggg ggccgtcgct       240
     gctctgaccc tgccggcgaa ccggggttcg ctagagataa ccttaagcag ccggctgcac       300
     aataagcggc tgtatgtccc caatgtgttg gtgctcgatc agcatctgcg cccggcggcc       360
     tactaccccg gcagctactt tacctaccgc cagcccggcg tgatgagcgg cgatcggttg       420
     gaggggacgc tgaagctgac gccggtgctg ggtcagcagc agatttatct gctgatttat       480
     accacccgtc aggatctggc cacgacgacc cgtatggtta accccgccaa ggcctatgcc       540
     gccggcgtgg gtaatgcggt gccggacatc cccgacccgc aggcgatgca tgcgccacag       600
     ggggtgctga acattcaggc acgggttgag cggcaaagtg gcaatgtgat gataggcggg       660
     ctgttaccga caggggatac accagtcgac gtggcggttg gcagcccggc gagtaccgtc       720
     gctgcgcctg cggcgccgat gctggatgat accgccgcct atttcgatcg cagcatccgc       780
     agcgcagtac gccagggcga tatcgataaa gcgctgcgcc tgatgaatga ggcgcagcga       840
     ctggggtcga cgacggcccg ggaaaccttt atccgcagcg taaaaggcaa gggttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page