(data stored in ACNUC7421 zone)

EMBL: CP001600.PE2

CP001600.PE2         Location/Qualifiers
FT   CDS_pept        1476..2576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0002"
FT                   /product="DNA polymerase III, beta subunit, putative"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67264"
FT                   /db_xref="GOA:C5BHC6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHC6"
FT                   /protein_id="ACR67264.1"
FT                   /translation="MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLT
FT                   GTDLEMEMVARVPLVQPHEAGATTVPARKFLDICRGLPDGAEISVALDGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRLLDGGETPLRLQIGSNN
FT                   LRAHVGGFIFTSKLVDGRFPDYRRVLPKNPDKALEAGCDELKQAFARAAILSNEKFRGV
FT                   RLHVSHNQLKITANNPEQEEAEELLDVDYPGSDLEIGFNVSYVLDVLNALKCERVVMML
FT                   TDAVSSVQIEDAASQAAVYVVMPMRL"
     atgaaattta ttgttgagcg tgagcatctt atcaagccgt tgcaacaggt gagcagcccg        60
     ctgggcgggc gtcctacgtt gccgattctg ggtaacctgt tgctgcaggt ggaagatggc       120
     catctgtcgc tgaccggcac cgatctcgag atggagatgg tggccagggt acccctggta       180
     cagccccatg aagcgggagc gacgacggtc ccggcgcgta agtttctgga tatttgccgc       240
     ggtctgccgg acggcgccga aatctcggtg gcgttggacg gcgatcgcat gctggttcgc       300
     tccgggcgca gccgtttttc tctgtctact ctaccggcag ctgattttcc aaacctggat       360
     gactggcaga gcgaggtaga gtttactctg ccgcaggcta cgctgaagcg cctgatcgag       420
     gcgacgcagt tttccatggc ccatcaggac gtccgctatt atctgaacgg tatgctgttt       480
     gaaaccgagg gcgaagagct acgcaccgtg gcgacggacg gtcatcgcct ggcagtctgt       540
     tcaatgccta tcgggcagag cctgccgagc cattcggtga tcgtaccgcg taaaggcgtc       600
     attgagctga tgcgtctgct ggacggtggc gagacgccgc tgcgcctgca gattggcagc       660
     aataacctgc gcgcccatgt cggggggttc atatttacct ccaagctggt tgatggacgt       720
     ttccctgatt atcgtcgcgt attgccaaaa aatccggata aagccctgga ggcaggttgt       780
     gacgaactga agcaggcctt tgcccgcgcg gcgatcctct ccaatgagaa attccgcggc       840
     gtacgcttgc atgtcagcca taaccagctg aagatcacgg ccaacaaccc ggagcaagaa       900
     gaggccgagg agctgctgga tgtggactat ccgggcagcg atctggagat cggctttaac       960
     gtgagctatg ttctggatgt gttaaacgcc ctgaagtgtg agcgggtggt gatgatgctg      1020
     acggatgcgg tttccagcgt acagatcgaa gatgccgcca gtcaggcggc agtgtatgtc      1080
     gtgatgccga tgcgtctgta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page