(data stored in ACNUC7421 zone)

EMBL: CP001600.PE20

CP001600.PE20        Location/Qualifiers
FT   CDS_pept        complement(18303..18551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0022"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67282"
FT                   /db_xref="GOA:C5B9A2"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9A2"
FT                   /protein_id="ACR67282.1"
FT                   /translation="MTDLFANPDKTLDALGLRCPEPVMMVRKTVRHMVAGETLLIIADD
FT                   PATTRDIPGFCRFMEHTLLAQEIEQTPYRYLLRKGGA"
     atgaccgatc tgttcgccaa tccggacaaa accctagacg ctctgggcct acgctgcccg        60
     gagccggtaa tgatggtacg caagaccgta cgccatatgg tggcgggcga aaccctgctg       120
     atcatcgccg atgatccggc aaccacccgc gatattcccg gcttctgccg ttttatggag       180
     cacaccctgc tggcgcagga gatcgagcag acaccctacc gctatctgct gcgcaaaggt       240
     ggcgcctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page