(data stored in ACNUC7421 zone)

EMBL: CP001600.PE200

CP001600.PE200       Location/Qualifiers
FT   CDS_pept        233595..233957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0226"
FT                   /product="diacylglycerol kinase, putative"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67469"
FT                   /db_xref="GOA:C5B707"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C5B707"
FT                   /protein_id="ACR67469.2"
FT                   /translation="MNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQESLLLVVAVMLA
FT                   CWLDVTAVERILLIGSVTLVVILEILNSAIEAVVDRIGSERHELSGRAKDMGSAAVFVA
FT                   LWLALFVWVSILWTHL"
     atgaatagta ctacaggttt gacccgaatc atcaaagcgg ccggttactc gatcaaagga        60
     ttgcaggcgg catggcgcca tgaggcggcg ttccgtcagg agagtctgct gctggttgtc       120
     gcggtgatgc tggcctgctg gcttgacgtc acggcggttg agcgcatttt gctgatcggc       180
     agcgtgacgc tggtggtgat cctggaaata ctcaacagcg ccattgaggc ggtggtggac       240
     cggattggca gcgagcgcca tgagctgtcc ggtcgcgcca aagatatggg ttcggcagca       300
     gtatttgtgg cgttgtggct ggcgctgttt gtctgggtca gcattctgtg gacgcatctg       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page