(data stored in ACNUC7421 zone)

EMBL: CP001600.PE207

CP001600.PE207       Location/Qualifiers
FT   CDS_pept        complement(239403..239702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0233"
FT                   /product="citrate lyase acyl carrier protein, putative"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67476"
FT                   /db_xref="GOA:C5B714"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B714"
FT                   /protein_id="ACR67476.1"
FT                   /translation="MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDA
FT                   IRATVLDVLNRYQVRGIQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA"
     atgaaaataa accacgcagc cgtcgctggc acccttgagt cgagcgacgt gatggtacgc        60
     atcgcgccca ttgaagacga ccaggctctc gatctgcaaa tcagcagcag cgtcgaaaaa       120
     cagtttggcg acgccatccg cgccaccgtg ctggacgtcc tcaaccgtta tcaggtgcgc       180
     ggcatacagc tgatcgttga cgataaaggt gcgcttgact gtgtcctgcg cgcacgtctg       240
     gaaaccctgc tggcgcgcgc cgccgacctg gtcagtctgc cctgggagga tcgcgcatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page