(data stored in ACNUC7421 zone)

EMBL: CP001600.PE209

CP001600.PE209       Location/Qualifiers
FT   CDS_pept        241163..242806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0235"
FT                   /product="sensor kinase DpiB, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67478"
FT                   /db_xref="GOA:C5B716"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C5B716"
FT                   /protein_id="ACR67478.1"
FT                   /translation="MVRMPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASF
FT                   EDYMMRQVHDMAMNQAKIIASMDSVVEGVKARDTHRLALIADRLGTGTDFDYVVIGDRN
FT                   SVRLYHPNPAKIGHKMQFTKPGAMEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVV
FT                   SLGYLVSKIDSWRLDFLLPMAGVFVCVLLLLLLLSWLFAAHIRRQMMGMEPRQIARVVR
FT                   QMEALFGAVFEGLIAVDPDGQITAINRNARKMLGLSAPGRQWLGQPISQVVSPSDFFTD
FT                   RINEDRRDAILTFNGLNVIANRATIRSGDGDTLLGAIISFRSKDDINTLNAQLTQIRQY
FT                   VDSLRTVRHEHLNWMSTLSGLLQMKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAG
FT                   LLFGKVHRARELGLTLTIVDGSQLHALPAGLDNTEFAAVLGNLLDNAFDASLKNPQGGG
FT                   GVEVYLSDEGREVIIEVADQGCGVPDTLKDNIFEQGVSTKAEDPGEHGIGLYLIARYVG
FT                   RCGGTITLEDNQPYGTLFSVFIPKVKREHE"
     atggtaagaa tgccgaataa cagtgcggtg aatttctttc gccgcatggc gttccccctg        60
     cgtatttttt tactgttact gctggtttcc tgctgcctgt ttgccgcgct ggggaagtac       120
     ctgtcagcca gctttgaaga ctacatgatg agacaggtgc acgacatggc gatgaaccag       180
     gccaagatca tcgcatcgat ggacagcgtt gtggaggggg tgaaggcgcg cgatacccac       240
     cgcttggcgc tgatcgccga tcgtctgggt accgggactg actttgacta tgtagtcatc       300
     ggcgatcgga actccgtccg cctgtatcat cccaatccgg ccaaaatcgg ccacaaaatg       360
     cagtttacca agccaggcgc catggagaag ggtgagagct attttatctc aggcaagggc       420
     tctctgggcc aggcactgcg cgcgaaaacg cccattttcg atcatcaggg gcaggtgatc       480
     ggggtcgttt ccctgggcta tctggtcagt aagattgata gctggcgcct ggacttcctg       540
     ctgcccatgg ccggggtctt cgtgtgtgtg ctgctgctgc tgctgctgct ctcctggcta       600
     tttgccgcgc atatccgacg acagatgatg gggatggagc cgcgtcagat agcccgggtg       660
     gtgcgtcaga tggaggccct gttcggcgcc gtatttgagg ggctgattgc ggtcgatcct       720
     gacggacaga tcacggcaat aaatcgcaat gcccgcaaaa tgctggggct aagcgcaccg       780
     ggccgccagt ggctgggaca gccgataagc caggtggtct cgccgtcaga ctttttcacc       840
     gatcgtatca atgaagatcg gcgtgatgcc attctcacct ttaacgggct gaacgtgata       900
     gccaaccggg cgaccatccg ctccggcgat ggcgatacgc tgctcggcgc gattatcagt       960
     ttccgcagca aggatgatat caatacgctt aatgcccagc tgacccagat ccgccagtat      1020
     gtcgacagtc tgcgcactgt gcgccatgag caccttaact ggatgtcgac gctgagcggg      1080
     ctgctgcaga tgaaagagta cgatcgggcg ctggagatgg tacgcggcgc gtcgcaggcg      1140
     cagcagcagc tgatcgaccg cctgcgcgat gcattcagtg acaaggtggt cgccgggctg      1200
     ctgtttggca aagtgcaccg ggcgcgcgag ctggggctga cgctgaccat cgtcgacggc      1260
     agccagctgc atgcgctacc ggcggggctg gacaacacgg agtttgcggc ggtattgggc      1320
     aatctgttgg ataatgcctt cgatgccagc ctgaagaacc cacagggggg cggcggcgtt      1380
     gaggtctatc tgtcggatga gggccgcgag gtcatcattg aagtggccga tcagggctgc      1440
     ggtgtcccgg atacgctgaa agacaacatt tttgagcagg gcgtgagcac caaggcggaa      1500
     gatcctgggg agcacggtat cggcctgtac cttattgccc gttatgtcgg gcgttgcgga      1560
     ggcaccatta cgctggagga taaccagccc tatggcactc tattttctgt ttttatcccg      1620
     aaggtgaagc gtgaacatga ataa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page