(data stored in ACNUC7421 zone)

EMBL: CP001600.PE21

CP001600.PE21        Location/Qualifiers
FT   CDS_pept        18770..19429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0023"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67283"
FT                   /db_xref="GOA:C5B9A3"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A3"
FT                   /protein_id="ACR67283.1"
FT                   /translation="MFSFTPQQRFTALCWLSLFHILIITSSNYLVQLPITVFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILAVMVPALLISYCVSALFFQGQWQGFAALGSV
FT                   NLMVARIACASFMAYVLGQILDVHVFNRLRQTQAWWVAPTASTLFGNISDTLSFFFIAF
FT                   YRSSDAFMATHWIEIALVDYAFKLLISMVFFLPMYGVMLNMLLKRIAFRQQQVSPA"
     atgttcagtt ttacaccgca gcagcggttt acagccctgt gttggctgtc tctatttcat        60
     atattaatta ttacatcaag taactatctg gtgcagctgc cgatcaccgt gttcggtttc       120
     cataccacct ggggcgcctt taccttcccg tttatctttt tggcgacgga tctgaccgtg       180
     cgtatctttg gcgccccgct ggcccggcgt attattttgg cggtgatggt gccagcgctg       240
     ctgatttcct actgtgtctc cgcccttttt tttcaggggc agtggcaggg ctttgccgcg       300
     ctgggcagcg tcaacctgat ggtcgcgcgc attgcctgcg ccagctttat ggcctatgtg       360
     ctggggcaaa tactggatgt gcatgtgttt aaccgcctgc ggcagacgca ggcctggtgg       420
     gtcgcaccga ccgcctcgac gctgtttggt aacatcagcg atacgctgtc gtttttcttt       480
     attgcttttt accgcagcag cgacgcgttt atggcaaccc actggatcga gatcgcactg       540
     gtggattatg cattcaaatt attgattagc atggttttct ttttgccgat gtacggtgtc       600
     atgctgaata tgctgctgaa gcggatagcg tttcgccagc aacaggtctc gccggcgtaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page