(data stored in ACNUC7421 zone)

EMBL: CP001600.PE212

CP001600.PE212       Location/Qualifiers
FT   CDS_pept        244368..245699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0238"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67481"
FT                   /db_xref="GOA:C5B719"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5B719"
FT                   /protein_id="ACR67481.1"
FT                   /translation="MRGVFREDKALWRLALPMILSNVSVPLLGVVDTAVIGHLDSPVYL
FT                   GGVAVGSMATTFLFMLLLFLRMSTTGLCAQAFGAADRPALARALLQPLIMALLAGVGII
FT                   LLRQPLSALMLQIVGAGAAIQAQAQLFMHIRWLSAPATLANLVILGWLLGVQYARAPVL
FT                   LLIVGNVVNIALDLWLVVGLGWKVAGAAWATVIADYVTLLMGAALLLHVMRLRGLRRAH
FT                   FRHAWRGNLRRLMALNRDIMLRSLLLQLCFASLTVIGARLGADIVAVNAVLMNLLTFTA
FT                   YALDGFAYAVEAYSGQAFGARDAPVLRRVWRAACRQAGAVALLFALAYSLFGRDIVNLL
FT                   TSLPQVQTLALDYLPWQVVLPLLGVWCYLLDGMFIGATRGADMRNSMAVAALGYGMTLL
FT                   SIPWLGNHGLWLALAVFLMLRGLSLWLIWRRRWRTQRWFPTGAA"
     atgcgaggcg ttttccggga agacaaggcg ctgtggcgcc tggcgctgcc gatgattctg        60
     tcgaatgtct ccgttcccct gctgggtgtg gtcgatacgg cggtgattgg tcatttggac       120
     tcgccggttt atctgggtgg cgtggcggtg ggcagtatgg ccaccacttt tttgtttatg       180
     ctgctgctgt ttttacgcat gagcaccacc gggctgtgtg cccaggcgtt cggcgctgcc       240
     gatcgcccgg cgctggcgcg ggcgttgctg cagccgctga tcatggccct gctggccggg       300
     gtgggcatta tcctgctacg ccagccgctc agcgcgctga tgctgcagat cgtcggcgcc       360
     ggggccgcaa tacaggcaca ggcgcagctg tttatgcata ttcgctggct gagtgcgccg       420
     gcgaccctgg ccaacctggt gattctgggc tggctgctgg gggtgcagta cgcccgggcg       480
     ccggtgctgc tgctgattgt cggcaatgtg gtgaatatcg cgctggatct gtggctggtg       540
     gtggggttgg gctggaaggt ggccggtgcc gcctgggcta cggtgatcgc tgactatgtc       600
     acgctgctga tgggggcagc gctgctgctg catgtgatgc gtctgcgtgg gctgcgccgg       660
     gcgcatttcc ggcacgcctg gcgcggtaac ctgcgccgcc tgatggcgct gaaccgcgat       720
     atcatgctgc gctccctgtt gctgcagctg tgcttcgcct cgctgacggt gatcggcgcg       780
     cggctggggg ccgacattgt ggccgtcaat gcggtgctga tgaatctgct gacctttacc       840
     gcctatgcgc tggatggctt tgcctatgct gtcgaggctt actccggcca ggcctttggc       900
     gcccgcgatg ccccggtgct gcgccgggta tggcgcgctg cctgccgtca ggcaggggcg       960
     gtagcgctac tgtttgcgct ggcctacagc ctgtttgggc gcgatattgt caatttgttg      1020
     acctcgttgc ctcaggtaca gaccctggcg ctcgactacc tgccctggca ggtcgtgctg      1080
     ccgctgctgg gagtgtggtg ctacctgctg gacggcatgt ttatcggtgc gacgcgcggg      1140
     gctgatatgc gtaacagcat ggcggtcgcg gccctgggat atggcatgac gctgctgagc      1200
     ataccgtggc tgggtaatca tgggctgtgg ctggcgctgg cggtattttt gatgctgcgc      1260
     ggtctctccc tgtggctgat ctggcgccgc cgctggcgca cccagcgctg gttccccacc      1320
     ggggcagcgt ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page