(data stored in ACNUC7421 zone)

EMBL: CP001600.PE214

CP001600.PE214       Location/Qualifiers
FT   CDS_pept        246630..247280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67483"
FT                   /db_xref="UniProtKB/TrEMBL:C5B721"
FT                   /protein_id="ACR67483.1"
FT                   /translation="MDLILAIEHWPLRQAIVELYRRQFTIISLPDAVPFSPRILSALHR
FT                   AGSLLVTDRQRHNLLQTVERVRRHSLIPVIIINRQDNYLTQLIARFFNGAHALSYDSFY
FT                   RHIQRRTFHPLDLYFLPYSRGAQDACWSTGETVYARLNAFGLMTLYQRGVTLREAAVLL
FT                   SLSYHNSTAMTARLLGIHEQAVVYCKRTLGSKLGLDHHRPDFISHIFLSPDAR"
     atggatctta ttttagcgat cgaacactgg ccgctgcgcc aggcgatagt ggagctttac        60
     cgacggcagt tcaccattat ttcactgccg gacgcggtac cattttcgcc ccgtatcctc       120
     agcgcgctgc atcgggccgg tagtctgctg gtgacggacc gacagcgcca taacctgctg       180
     cagactgtgg agagggtgcg ccgccatagt ctgattccgg tgatcatcat taaccggcag       240
     gataactacc tgacccagct gattgcccgt ttttttaacg gtgcccacgc cctgagctac       300
     gattcgtttt accgccatat tcagcggcgt acctttcatc cgctggatct ctattttttg       360
     ccctattcgc gcggcgcaca ggacgcctgc tggagcactg gtgagacggt gtatgcccgg       420
     ctaaatgcct ttggcctgat gacgctctac cagcgcgggg ttaccctgcg cgaagctgcg       480
     gtgctgctca gtctctctta ccataacagt acggcgatga ccgcccgcct attggggatc       540
     catgagcagg cggtggtgta ctgcaagcga acactgggga gtaagctggg gctggaccat       600
     caccggcccg actttatcag ccacattttc ctctctccgg acgcgcggta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page