(data stored in ACNUC7421 zone)

EMBL: CP001600.PE223

CP001600.PE223       Location/Qualifiers
FT   CDS_pept        complement(255423..256055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0249"
FT                   /product="Opacity family porin protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67492"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC9"
FT                   /protein_id="ACR67492.1"
FT                   /translation="MKAFTKLALFVGLVSGATLANAAGTNNTGYYAGAKMGISAEHLFD
FT                   QKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRAHATSSHTNDAAETN
FT                   NSRLGLQTLMVNGYYDIKTGTPFTPYIGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVG
FT                   TGVIYNVNERLDLDLGYKYLDAGKANAGNSQAKVATHDFTLGVNYYF"
     atgaaagcat tcactaaact ggccctgttc gtaggtctgg tctccggcgc aactctggcc        60
     aacgctgcag gtaccaacaa taccggttac tatgccggtg ccaaaatggg tatcagcgcc       120
     gagcatctgt tcgatcagaa agatgttaat ggcaatggca tgagcaacga taacaaaggc       180
     gtcggtaacg ccggtctggt tttcggctat aacttcgaaa accagttcag cctgccggtt       240
     cgcgctgagc tggactacac cttccgcgct cacgccacct ccagccatac caacgatgcc       300
     gcagagacta acaacagccg tctgggtctg cagacgctga tggttaacgg atactatgac       360
     atcaaaaccg gtacgccttt cactccgtac atcggcgccg gtatcggtta tgctaatgtc       420
     agcctgaaaa acgacatgaa cggcgacaac gtacagagca acagcaataa ctttgcctgg       480
     agcgtcggta ccggtgtgat ctacaacgtt aacgagcgtc tggatctgga tctgggctac       540
     aaatacctgg acgcaggcaa agccaacgcc ggtaactccc aggccaaagt ggccacccat       600
     gactttactc tgggtgtgaa ctactacttc taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page