(data stored in ACNUC7421 zone)

EMBL: CP001600.PE224

CP001600.PE224       Location/Qualifiers
FT   CDS_pept        256800..257654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0250"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67493"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD0"
FT                   /protein_id="ACR67493.1"
FT                   /translation="MIHLFNSMNIYPGIPIPDIPAENSSPEPDAVAAVLDSRHNYERIL
FT                   CHGPLSGVKSIEAGGNTTLLKFIERLMQERQFIDTLNEKNNQSYNSMYALEQIISEIGV
FT                   NSEEEIKISSALKQAVSDINHSIADVNRLSNQTNLPAMETAHVSAQGCGFSFIVKVIKS
FT                   RASEVKQHAAQIALLSNTISARAGQVCESVSAIHALITRISQEMASTSETLEQVIERSG
FT                   HMQKIIHHIAIQQFLNMVKRVHIIWKYQVCHYLFIRDRQAVMNVHHSCRLGHRYYTGEG
FT                   VMI"
     atgattcatc tgtttaattc aatgaatatt tatcccggta tacccatacc ggatatccct        60
     gctgaaaatt catctcctga gcctgatgcg gtagcggctg tacttgattc acgacacaac       120
     tacgaacgta ttctttgcca cggtcctctc tctggagtga aaagtatcga ggctggcggt       180
     aatactactc tactaaaatt cattgagcga ctgatgcagg aacggcagtt cattgacaca       240
     ttgaatgaaa aaaataatca atcatataat agcatgtatg cgttggagca gattatcagt       300
     gagatagggg tgaactcgga ggaggagatt aaaatcagca gcgctttgaa acaggcggta       360
     tcggatatca atcacagcat tgcagatgtt aaccggttat ctaatcaaac caatctgccg       420
     gcgatggaga cagcacatgt cagcgcgcag ggatgtggct ttagctttat cgttaaagtg       480
     attaaatcac gggccagtga ggtgaaacag catgcggcgc agattgcttt gcttagcaat       540
     actatttccg cccgtgccgg gcaggtatgc gagagtgttt ctgcgatcca tgctttgatt       600
     acacgtatca gccaggagat ggcgtcaacc agtgagacat tggagcaagt tattgagcgc       660
     tctggccata tgcaaaagat cattcatcat atcgcgatac agcaattctt aaatatggta       720
     aagcgggttc atattatttg gaaataccag gtttgccatt atttatttat tcgcgatcgg       780
     caggccgtaa tgaacgttca tcactcttgc cgtttggggc atcggtatta tactggggag       840
     ggggtgatga tttag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page